‘cat psychology’ directory
- See Also
- Gwern
- Links
- “Do You like Dogs, Cats, Both, or Neither? ”, Kirkegaard 2025
- “Lessons From a Lost-Pet Detective Named Kat: Recovering Missing Animals Requires Understanding Both Animal and Human Behavior. ”, Anthes & Albrecht 2025
- “Why Are Cats Such a Medical Black Box? ”, Anthes 2025
- “Types of Environmental Enrichments Offered for Cats and Their Association With Housing Features And ”, Gonçalves et al 2025
- “Influence Of Improper Play With The Cat On The Frequency Of Aggressive Behavior ”, Wojtaś et al 2025
- “‘I Could Work Every Day of the Week’: the Life of a UK Pet Detective As Thefts Rise: Colin Butcher and His Dog Molly Are Increasingly in Demand As Bereft Owners Hunt for Missing Cats and Dogs ”, Al-Othman 2024
- “Rapid Formation of Picture-Word Association in Cats ”, Takagi et al 2024
- “Cats Are (Almost) Liquid!—Cats Selectively Rely on Body Size Awareness When Negotiating Short Openings ”, Pongrácz 2024
- “Is Companion Animal Loss Cat-Astrophic? Responses of Domestic Cats to the Loss of Another Companion Animal ”, Greene & Vonk 2024
- “Generation of Olfactory Compounds in Cat Food Attractants: Chicken Liver-Derived Protein Hydrolysates and Their Contribution to Enhancing Palatability ”, Wei et al 2024
- “Too Much Too Soon? Risk Factors for Fear Behavior in Foster Kittens prior to Adoption ”, Graham et al 2024
- “Cat Owners’ Anthropomorphic Perceptions of Feline Emotions and Interpretation of Photographs ”, Bouma et al 2024
- “Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis: Supplement ”, McGrath et al 2023
- “Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis ”, McGrath et al 2023
- “Feline Faces: Unraveling the Social Function of Domestic Cat Facial Signals ”, Scott & Florkiewicz 2023
- “Things Nobody Will Tell You About Having an African Serval ”, Serval 2023
- “Examining Leopard Attacks: Spatio-Temporal Clustering of Human Injuries and Deaths in Western Himalayas, India ”, Shivakumar et al 2023
- “Multimodal Communication in the Human-Cat Relationship: A Pilot Study ”, Mouzon & Leboucher 2023
- “The Bluestocking, Vol 267: Fascinated by the Smell & Taste of Earwax ”, Lewis 2023
- “A New Level of Relationship between Puma Messi and Cheetah Gerda! Amazing Progress! ”, Sasha & Masha 2022
- “Discrimination of Cat-Directed Speech from Human-Directed Speech in a Population of Indoor Companion Cats (Felis Catus) ”, Mouzon et al 2022
- “Cats Learn the Names of Their Friend Cats in Their Daily Lives ”, Takagi et al 2022
- “Mapping the ‘Catscape’ Formed by a Population of Pet Cats With Outdoor Access ”, Bischof et al 2022
- “Assessing Cats’ (Felis Catus) Sensitivity to Human Pointing Gestures ”, Maeses & Wascher 2022
- “Why Cats Love Earwax § Comments ”, patience_limited 2022
- “Introduction of Adult Cats to Indirect Calorimetry Respiration Chambers Causes Increased Energy Expenditure and Respiratory Quotient That Decrease following Acclimation ”, Hogan et al 2022b
- “A Domestic Cat (Felis Silvestris Catus) Model of Triarchic Psychopathy Factors: Development and Initial Validation of the CAT-Tri+ Questionnaire ”, Evans et al 2021
- “Stress-Related Behaviors in Companion Dogs Exposed to Common Household Noises, and Owners’ Interpretations of Their Dogs’ Behaviors ”, Grigg et al 2021
- “Jurassic Park but With a Cat [T-Rex Night Scene] ”, OwlKitty 2021
- “Are Cats Good? An Important Study ”, Owen & Lamon 2021b
- “Socio-Spatial Cognition in Cats: Mentally Mapping Owner’s Location from Voice ”, Takagi et al 2021
- “Diet and Activity Pattern of Leopard in Relation to Prey in Tropical Forest Ecosystem ”, Palei et al 2021
- “Domestic Cats (Felis Catus) Prefer Freely Available Food over Food That Requires Effort ”, Delgado et al 2021
- “If I Fits I Sits: A Citizen Science Investigation into Illusory Contour Susceptibility in Domestic Cats (Felis Silvestris Catus) ”, Smith et al 2021b
- “My Cat Chester’s Dynamical Systems Analysyyyyy7777777777777777y7is of the Laser Pointer and the Red Dot on the Wall: Correlation, Causation, or SARS-Cov-2 Hallucination? ”, Armstrong & Chester 2021
- “The Mechanics of Social Interactions Between Cats and Their Owners ”, Turner 2021
- “The Family Dog Is in Sync With Your Kids: Dogs Orient and Move in Synchrony With Family Members, Which May Have Implications for the Emotional Development of People and Pets ”, Reynolds 2021
- “Provision of High Meat Content Food and Object Play Reduce Predation of Wild Animals by Domestic Cats ”, Cecchetti et al 2021
- “Cats (Felis Catus) Show No Avoidance of People Who Behave Negatively to Their Owner ”, Chijiiwa et al 2021
- “Family Member, Best Friend, Child or ‘Just’ a Pet, Owners’ Relationship Perceptions and Consequences for Their Cats ”, Bouma et al 2021
- “Exploratory Study of Cat Adoption in Families of Children With Autism: Impact on Children’s Social Skills and Anxiety ”, Carlisle et al 2020
- “Toxoplasmosis: Recent Advances in Understanding the Link Between Infection and Host Behavior ”, Johnson & Johnson 2020b
- “The Role of Cat Eye Narrowing Movements in Cat-Human Communication ”, Humphrey et al 2020
- “Did We Find a Copycat? ‘Do As I Do’ in a Domestic Cat (Felis Catus) ”, Fugazza et al 2020
- “The Daytime Feeding Frequency Affects Appetite-Regulating Hormones, Amino Acids, Physical Activity, and Respiratory Quotient, but Not Energy Expenditure, in Adult Cats Fed Regimens for 21 Days ”, Camara et al 2020
- “Taste Preferences and Diet Palatability in Cats ”, Pekel et al 2020
- “Not the Cat’s Meow? The Impact of Posing With Cats on Female Perceptions of Male Dateability ”, Kogan & Vlosche 2020
- “Effectiveness of the Felixer Grooming Trap for the Control of Feral Cats: a Field Trial in Arid South Australia ”, Moseby et al 2020
- Кошки-Мышки: Кто Нас Создал, И Во Что Нам Это Обошлось—Станислав Дробышевский, Drobyshevsky 2020
- “The Relationship Between Neuroticism Facets, Conscientiousness, and Human Attachment to Pet Cats ”, Reevy & Delgado 2020b
- “Body Size and Bite Force of Stray and Feral Cats ”, Fleming et al 2020
- “The Small Home Ranges and Large Local Ecological Impacts of Pet Cats ”, Kays et al 2020
- “Where There Are Girls, There Are Cats ”, Li et al 2020b
- “Cats, Once YouTube Stars, Are Now an ‘Emerging Audience’: They’re Addicted to Channels like Little Kitty & Family, Handsome Nature, and Videos for Your Cat—Provided Their Owners Switch on the IPad First ”, Lazzaro 2020
- “Facial Expressions of Pain in Cats: the Development and Validation of a Feline Grimace Scale ”, Evangelista et al 2019
- “The Scavenging Patterns of Feral Cats on Human Remains in an Outdoor Setting ”, Garcia et al 2019
- “Humans Can Identify Cats’ Affective States from Subtle Facial Expressions ”, Dawson et al 2019
- “Motion Illusions As Environmental Enrichment for Zoo Animals: A Preliminary Investigation on Lions (Panthera Leo) ”, Regaiolli et al 2019
- “Attachment Bonds between Domestic Cats and Humans ”, Vitale et al 2019
- “The Effect of a Hiding Box on Stress Levels and Body Weight in Dutch Shelter Cats; a Randomized Controlled Trial ”, Leij et al 2019
- “Characterization of Plant Eating in Cats ”, Hart et al 2019
- “Breed Differences of Heritable Behavior Traits in Cats ”, Salonen et al 2019
- “A Review of the Development and Functions of Cat Play, With Future Research Considerations ”, Delgado & Hecht 2019
- “Black Cat Bias: Prevalence and Predictors ”, Jones & Hart 2019
- “Target Specificity of the Felixer Grooming "trap" ”, Read et al 2019
- “Dogs Have Masters, Cats Have Staff: Consumers’ Psychological Ownership and Their Economic Valuation of Pets ”, Kirk 2019
- “Intestinal Delta-6-Desaturase Activity Determines Host Range for Toxoplasma Sexual Reproduction ”, Genova et al 2019
- “Jurassic Park: Starring My Cat [Velociraptors Kitchen Scene] ”, OwlKitty 2018
- “Cats Parallel Great Apes and Corvids in Motor Self-Regulation—Not Brain but Material Size Matters ”, Bobrowicz & Osvath 2018
- “The Socio-Cognitive Relationship between Cats and Humans—Companion Cats (Felis Catus) As Their Owners See Them ”, Pongrácz & Szapu 2018
- “How Mammals Stay Healthy in Nature: the Evolution of Behaviors to Avoid Parasites and Pathogens ”, Hart & Hart 2018
- “Why Scientists Love to Study Dogs (And Often Ignore Cats) ”
- “Perception of the Delboeuf Illusion by the Adult Domestic Cat (Felis Silvestris Catus) in Comparison With Other Mammals ”, Szenczi et al 2018
- “Marijuana Intoxication in a Cat ”, Janeczek et al 2018
- “Postmortem Scavenging of Human Remains by Domestic Cats ”, Suntirukpong et al 2017
- “Effects of Latent Toxoplasmosis on Olfactory Functions of Men and Women ”, Flegr et al 2017
- “Use of Incidentally Encoded Memory from a Single Experience in Cats ”, Takagi et al 2017
- “Habitat Preference for Fire Scars by Feral Cats in Cape York Peninsula, Australia ”, McGregor et al 2017
- “Nature’s Balance #5 [The Cat Evolutionary Strategy] ”, Pereira 2016
- “Impact of Macronutrient Composition and Palatability in Wet Diets on Food Selection in Cats ”, Salaun et al 2016
- “We Went to NASA to Float on the World’s Flattest Floor: In a Warehouse in Alabama Is What May Be the Flattest Floor in the World—One That Can, in a Sense, Simulate Space. BBC Future—And Some Cats—Give It a Test Drive ”, Hollingham 2016
- “Is Toxoplasma Gondii Infection Related to Brain and Behavior Impairments in Humans? Evidence from a Population-Representative Birth Cohort ”, Sugden et al 2016
- “Chapter 11: Housing Cats in the Veterinary Practice ”, Rodan & Cannon 2016
- “The Roles of Pet Dogs and Cats in Human Courtship and Dating ”, Gray et al 2015
- “Emotion Regulation, Procrastination, and Watching Cat Videos Online: Who Watches Internet Cats, Why, and to What Effect? ”, Myrick 2015
- “The Relationship Between Coat Color and Aggressive Behaviors in the Domestic Cat ”, Stelow et al 2015
- “What’s inside Your Cat’s Head? A Review of Cat (Felis Silvestris Catus) Cognition Research Past, Present and Future ”, Shreve & Udell 2015
- “Stress in Owned Cats: Behavioral Changes & Welfare Implications ”, Amat et al 2015
- “Audiogenic Reflex Seizures in Cats ”, Lowrie et al 2015
- “Assessing Food Preferences in Dogs and Cats: A Review of the Current Methods ”, Tobie et al 2015
- “Feral Cats Are Better Killers in Open Habitats, Revealed by Animal-Borne Video ”, McGregor et al 2015
- “Cats and Illusory Motion ”, Bååth et al 2014
- “Executive Summary of Phase 3 of the Bayer Veterinary Care Usage Study ”, Volk et al 2014
- “Are Cats (Felis Catus) from Multi-Cat Households More Stressed? Evidence from Assessment of Fecal Glucocorticoid Metabolite Analysis ”, Ramos et al 2013
- “How to Make a Raptor Suit ”, Rosengrant 2012
- “Chapter 11: Undesired Behavior in the Domestic Cat (The Behavior of the Domestic Cat, Second Edition) ”, Bradshaw et al 2012
- “Chapter 12: Physiological and Pathological Causes of Behavioral Change (The Behavior of the Domestic Cat, Second Edition) ”, Bradshaw et al 2012
- “Chapter 3: Mechanisms of Behavior (The Behavior of the Domestic Cat, Second Edition) ”, Bradshaw et al 2012
- “Chapter 8: Social Behavior (The Behavior of the Domestic Cat, Second Edition) ”, Bradshaw et al 2012
- “Escape Behavior of Birds Provides Evidence of Predation Being Involved in Urbanization ”, Moslashller & Ibáñez-Álamo 2012
- “Human Perceptions of Coat Color As an Indicator of Domestic Cat Personality ”, Delgado et al 2012
- “Executive Summary of Phase 2 of the Bayer Veterinary Care Usage Study ”, Volk et al 2011
- “The Search for Stability on Narrow Supports: an Experimental Study in Cats and Dogs ”, Gálvez-López et al 2011
- “Geometric Analysis of Macronutrient Selection in the Adult Domestic Cat, Felis Catus ”, Hewson-Hughes et al 2011
- “Christopher Smart’s "Jubilate Agno" ”, Key 2011
- “Breed Differences in Behavioral Response to Challenging Situations in Kittens ”, Marchei et al 2011
- “The Influence of Predation on Primate and Early Human Evolution: Impetus for Cooperation ”, Hart & Sussman 2011
- “Preferences for Infant Facial Features in Pet Dogs and Cats ”, Archer & Monton 2010
- “The Cry Embedded within the Purr ”, McComb et al 2009
- “The Taming of the Cat ”
- “Why Do Dogs and Cats Eat Grass? (A) They Are Sick and Need to Vomit. (B) They Have a Dietary Deficiency. (C) Studies Point to a Third Option That May May Well Be the Correct Answer to This Often-Asked Client Question ”, Hart 2008
- “Cat Vs Printer ”, gamook19 2008
- “The Influence of Visual Stimulation on the Behavior of Cats Housed in a Rescue Shelter ”, Ellis & Wells 2008
- “Characterisation of Plant Eating in Dogs ”, Sueda et al 2008
- “A Case of Recurrent Feline Idiopathic Cystitis: The Control of Clinical Signs With Behavior Therapy ”, Seawright et al 2008
- “Jurassic Park: The Evolution of a Raptor Suit With John Rosengrant ”, Duncan 2006
- “Lion Attacks on Humans in Tanzania ”, Packer et al 2005
- “A Comparative Study of the Use of Visual Communicative Signals in Interactions Between Dogs (Canis Familiaris) and Humans and Cats (Felis Catus) and Humans ”, Miklosi et al 2005
- “Chapter 3: The Human-Cat Relationship ”, Bernstein 2005
- “Perceptual and Acoustic Evidence for Species-Level Differences in Meow Vocalizations by Domestic Cats (Felis Catus) and African Wild Cats (Felis Silvestris Lybica) ”, Nicastro 2004
- “Influence of Familiarity and Relatedness on Proximity and Allogrooming in Domestic Cats (Felis Catus) ”, Curtis et al 2003
- “Validation of a Temperament Test for Domestic Cats ”, Siegford et al 2003
- “Leopard Predation and Primate Evolution ”, Zuberbühler & Jenny 2002
- “Object Play in Adult Domestic Cats: the Roles of Habituation and Disinhibition ”, Hall et al 2002
- “Evidence Suggesting Pre-Adaptation to Domestication throughout the Small Felidae ”, Cameron-Beaumont et al 2002
- “Responses of Pet Cats to Being Held by an Unfamiliar Person, from Weaning to Three Years of Age ”, Lowe & Bradshaw 2002
- “Responses of Cats to Petting by Humans ”, Soennichsen & Chamove 2002
- “Self-Induced Increase of Gut Motility and the Control of Parasitic Infections in Wild Chimpanzees ”, Huffman & Caton 2001
- “Long-Term Follow up of the Effect of a Pheromone Therapy on Feline Spraying Behavior ”, Mills & White 2000
- “Chapter 5: The Signaling Repertoire of the Domestic Cat and Its Undomesticated Relatives (The Domestic Cat: The Biology of Its Behavior) ”, Bradshaw & Cameron-Beaumont 2000
- “Chapter 7: Density, Spatial Organisation and Reproductive Tactics in the Domestic Cat and Other Felids (The Domestic Cat: The Biology of Its Behavior) ”, Liberg et al 2000
- “Chapter 10: The Human-Cat Relationship (The Domestic Cat: The Biology of Its Behavior) ”, Turner & Karsh 2000
- “The Ecology of Fear: Optimal Foraging, Game Theory, and Trophic Interactions ”, Brown et al 1999
- “Affiliative Behavior of Related and Unrelated Pairs of Cats in Catteries: a Preliminary Report ”, Bradshaw & Hall 1999b
- “The Social Bond between Man and Cat ”, Sandem & Braastad 1999
- “The Function of Allogrooming in Domestic Cats (Felis Silvestris Catus); a Study in a Group of Cats Living in Confinement ”, Bos 1998
- “Visual and Tactile Communication in the Domestic Cat (Felis Silvestris Catus) and Undomesticated Small Felids ”, Cameron-Beaumont 1997
- “Perceptual Cues That Permit Categorical Differentiation of Animal Species by Infants ”, Quinn & Eimas 1996
- “Leaf-Swallowing by Chimpanzees: A Behavioral Adaptation for the Control of Strongyle Nematode Infections ”, Huffman et al 1996
- “Factors Influencing the Reactions of Cats to Humans and Novel Objects ”, Ledger & O’Farrell 1996
- “Social Behavior of Domestic Cats ”, Voith & Borchelt 1996
- “A Game of Cat and House: Spatial Patterns and Behavior of 14 Domestic Cats (Felis Catus) in the Home ”, Bernstein & Strack 1996
- “The Vomeronasal Organ of the Cat ”, Salazar et al 1996
- “Development of Exclusivity in Perceptually Based Categories of Young Infants ”, Eimas et al 1994
- “Postmortem Injuries by Indoor Pets ”, Rossi et al 1994
- “The Costs and Benefits of Predator Inspection Behavior in Thomson’s Gazelles ”, FitzGibbon 1994
- “Methods of Scent Marking in the Domestic Cat ”, Feldman 1994
- “Predation on Primates: Ecological Patterns and Evolutionary Consequences ”, Isbell 1994
- “Urinary Monitoring of Adrenal Responses to Psychological Stressors in Domestic and Nondomestic Felids ”, Carlstead et al 1992
- “Effects of Early Rearing Experience on Subsequent Adult Sexual Behavior Using Domestic Cats (Felis Catus) As a Model for Exotic Small Felids ”, Mellen 1992
- “Illusory Contour Orientation Discrimination in the Cat ”, Weerd et al 1990
- “The Effects of Litter-Size Variation on the Development of Play Behavior in the Domestic Cat: Litters of One and Two ”, Mendl 1988
- “Cats See Subjective Contours ”
- “The Role of Vibrissae in Behavior: A Status Review ”, Ahl 1986
- “Size-Dependent Predation on Rats (Rattus Norvegicus) by House Cats (Felis Catus) in an Urban Setting ”, Childs 1986
- “Primal Self ”, Davis et al 1984
- “Feeding Behavior in the Cat—Recent Advances ”, Thorne 1982
- “The Curious Cat ”, Allaby & Crawford 1982
- “The Effects of Social Isolation on the Behavior of Juvenile Domestic Cats ”, Guyot et al 1980
- “External Influences on the Feeding of Carnivores ”, Mugford 1977
- “Flavor Preferences in Cats (Felis Catus and Panthera Sp.) ”, Beauchamp et al 1977
- “Chemocommunication among Domestic Cats, Mediated by the Olfactory and Vomeronasal Senses: I. Chemocommunication ”
- “Taste of Water in the Cat: Effects on Sucrose Preference ”, Bartosuk et al 1971
- “Cat Color Vision: Evidence for More Than One Cone Process ”, Daw & Pearlman 1970
- “Maternal Influence in Learning by Observation in Kittens ”, Chesler 1969
- “The Communal Organization of Solitary Mammals ”, Leyhausen 1969
- “Observation Learning in Cats ”, John et al 1968
- “What Children Fear ”, Maurer 1965
- The Psychology of Learning, Revised Edition, Guthrie 1960
- “Studies on the Basic Factors in Animal Fighting: VII. Inter-Species Coexistence in Mammals ”, Kuo 1960
- “Species Differences in Taste Preferences ”, Carpenter 1956
- “Some Factors of Observational Learning in Cats ”, Adler 1955
- “Sweet Taste in the Cat and the Taste-Spectrum ”, Frings 1951
- “Observational Learning by Cats ”, Herbert & Harsh 1944
- “Le Chat (The Cat) [Multiple Translations] ”, Baudelaire 1857
- “Do Cats Have Intelligence/How Intelligent Are Cats? ”
- “Do Cats Have Intelligence/How Intelligent Are Cats? § 2 ”
- “Determining Cat Chirality ”
- “Furiosa’s Cat Feeder: The Trick Is to Be Smarter Than the Animal With a Brain the Size of a Walnut ”
- “Study: Prevalence of Pet Anxiety in the US, 2022 ”
- “Whisker Fatigue in Cats: Causes, Symptoms, and Remedies ”
- “Cat Meow Sounds Visualized As ACF Images ”
- “How Well Can You Read Cat Faces? Test Yourself to See! This Short Quiz Contains 8 Video Clips of the Faces of Cats in Positive or Negative Emotional States (Selected from the 40 Videos Used in Our Recent Study). ”
- “Dr John Bradshaw (Bristol Veterinary School) ”
- “Another Study Shows That Feliway™ Doesn’t Work ”
- “The Hidden Reason Processed Pet Foods Are so Addictive ”
- “The Charles Mingus CAT-Alog for Toilet Training Your Cat [1954] ”
- “Gourmand Cat Fence ”
- “More Wild Men’s Pulp Magazine Stories about Leopard Men and Leopard Women… ”
- “Pets on Pot: The Newest Customer Base for Medical Marijuana ”
- “I Can’t Give My Cat the Perfect Life. ‘TV for Cats’ Gives Her a Taste. ”
- “Petting Your Cat ”
- “Researchers Put Little Hats on Cats to Measure Their Brainwaves ”
- “Non-Invasive Electroencephalography in Awake Cats: Feasibility and Application to Sensory Processing in Chronic Pain ”
- “Morbid Attraction to Leopard Urine in Toxoplasma-Infected Chimpanzees ”
- “Japanese Researcher Publishes Study on Quality of Sleep When Pet Cats Choose Location of Slumber ”
- “In Search of the Heart of the Online Cat-Industrial Complex ”
- “Layla ”, Meskhout 2026
- “Cats, Rats, AI, Oh My! ”
- “Cat + Tape = Experiment ”
- “Campbell Pet Company’s ‘EZ Nabber’ ”
- “Decerebrate Cat Walks and Exhibits Multiple Gait Patterns ”
- Sort By Magic
- Wikipedia (26)
- Miscellaneous
- Bibliography
See Also
Gwern
“Why Cats Love Earwax ”, Gwern 2019
“Cat Itecture: Better Cat Window Boxes ”, Gwern 2023
“Why Cats Knock Stuff Over ”, Gwern 2023
“Fuzz Testing ”, Gwern 2018
“Cat Psychology & Domestication: Are We Good Owners? ”, Gwern 2018
“What Is It Like To Be A Cat Tail? ”, Gwern 2021
Links
“Do You like Dogs, Cats, Both, or Neither? ”, Kirkegaard 2025
“Lessons From a Lost-Pet Detective Named Kat: Recovering Missing Animals Requires Understanding Both Animal and Human Behavior. ”, Anthes & Albrecht 2025
“Why Are Cats Such a Medical Black Box? ”, Anthes 2025
“Types of Environmental Enrichments Offered for Cats and Their Association With Housing Features And ”, Gonçalves et al 2025
Types of Environmental Enrichments Offered for Cats and their Association with Housing Features and
“Influence Of Improper Play With The Cat On The Frequency Of Aggressive Behavior ”, Wojtaś et al 2025
Influence Of Improper Play With The Cat On The Frequency Of Aggressive Behavior
“‘I Could Work Every Day of the Week’: the Life of a UK Pet Detective As Thefts Rise: Colin Butcher and His Dog Molly Are Increasingly in Demand As Bereft Owners Hunt for Missing Cats and Dogs ”, Al-Othman 2024
“Rapid Formation of Picture-Word Association in Cats ”, Takagi et al 2024
“Cats Are (Almost) Liquid!—Cats Selectively Rely on Body Size Awareness When Negotiating Short Openings ”, Pongrácz 2024
“Is Companion Animal Loss Cat-Astrophic? Responses of Domestic Cats to the Loss of Another Companion Animal ”, Greene & Vonk 2024
“Generation of Olfactory Compounds in Cat Food Attractants: Chicken Liver-Derived Protein Hydrolysates and Their Contribution to Enhancing Palatability ”, Wei et al 2024
“Too Much Too Soon? Risk Factors for Fear Behavior in Foster Kittens prior to Adoption ”, Graham et al 2024
Too much too soon? Risk factors for fear behavior in foster kittens prior to adoption
“Cat Owners’ Anthropomorphic Perceptions of Feline Emotions and Interpretation of Photographs ”, Bouma et al 2024
Cat owners’ anthropomorphic perceptions of feline emotions and interpretation of photographs
“Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis: Supplement ”, McGrath et al 2023
“Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis ”, McGrath et al 2023
“Feline Faces: Unraveling the Social Function of Domestic Cat Facial Signals ”, Scott & Florkiewicz 2023
Feline faces: Unraveling the social function of domestic cat facial signals
“Things Nobody Will Tell You About Having an African Serval ”, Serval 2023
“Examining Leopard Attacks: Spatio-Temporal Clustering of Human Injuries and Deaths in Western Himalayas, India ”, Shivakumar et al 2023
“Multimodal Communication in the Human-Cat Relationship: A Pilot Study ”, Mouzon & Leboucher 2023
Multimodal Communication in the Human-Cat Relationship: A Pilot Study
“The Bluestocking, Vol 267: Fascinated by the Smell & Taste of Earwax ”, Lewis 2023
The Bluestocking, vol 267: fascinated by the smell & taste of earwax
“A New Level of Relationship between Puma Messi and Cheetah Gerda! Amazing Progress! ”, Sasha & Masha 2022
A new level of relationship between puma Messi and cheetah Gerda! Amazing progress!
“Discrimination of Cat-Directed Speech from Human-Directed Speech in a Population of Indoor Companion Cats (Felis Catus) ”, Mouzon et al 2022
“Cats Learn the Names of Their Friend Cats in Their Daily Lives ”, Takagi et al 2022
Cats learn the names of their friend cats in their daily lives
“Mapping the ‘Catscape’ Formed by a Population of Pet Cats With Outdoor Access ”, Bischof et al 2022
Mapping the ‘catscape’ formed by a population of pet cats with outdoor access
“Assessing Cats’ (Felis Catus) Sensitivity to Human Pointing Gestures ”, Maeses & Wascher 2022
Assessing cats’ (Felis catus) sensitivity to human pointing gestures
“Why Cats Love Earwax § Comments ”, patience_limited 2022
“Introduction of Adult Cats to Indirect Calorimetry Respiration Chambers Causes Increased Energy Expenditure and Respiratory Quotient That Decrease following Acclimation ”, Hogan et al 2022b
“A Domestic Cat (Felis Silvestris Catus) Model of Triarchic Psychopathy Factors: Development and Initial Validation of the CAT-Tri+ Questionnaire ”, Evans et al 2021
“Stress-Related Behaviors in Companion Dogs Exposed to Common Household Noises, and Owners’ Interpretations of Their Dogs’ Behaviors ”, Grigg et al 2021
“Jurassic Park but With a Cat [T-Rex Night Scene] ”, OwlKitty 2021
“Are Cats Good? An Important Study ”, Owen & Lamon 2021b
“Socio-Spatial Cognition in Cats: Mentally Mapping Owner’s Location from Voice ”, Takagi et al 2021
Socio-spatial cognition in cats: Mentally mapping owner’s location from voice
“Diet and Activity Pattern of Leopard in Relation to Prey in Tropical Forest Ecosystem ”, Palei et al 2021
Diet and activity pattern of leopard in relation to prey in tropical forest ecosystem
“Domestic Cats (Felis Catus) Prefer Freely Available Food over Food That Requires Effort ”, Delgado et al 2021
Domestic cats (Felis catus) prefer freely available food over food that requires effort
“If I Fits I Sits: A Citizen Science Investigation into Illusory Contour Susceptibility in Domestic Cats (Felis Silvestris Catus) ”, Smith et al 2021b
“My Cat Chester’s Dynamical Systems Analysyyyyy7777777777777777y7is of the Laser Pointer and the Red Dot on the Wall: Correlation, Causation, or SARS-Cov-2 Hallucination? ”, Armstrong & Chester 2021
“The Mechanics of Social Interactions Between Cats and Their Owners ”, Turner 2021
The Mechanics of Social Interactions Between Cats and Their Owners
“The Family Dog Is in Sync With Your Kids: Dogs Orient and Move in Synchrony With Family Members, Which May Have Implications for the Emotional Development of People and Pets ”, Reynolds 2021
“Provision of High Meat Content Food and Object Play Reduce Predation of Wild Animals by Domestic Cats ”, Cecchetti et al 2021
“Cats (Felis Catus) Show No Avoidance of People Who Behave Negatively to Their Owner ”, Chijiiwa et al 2021
Cats (Felis catus) Show No Avoidance of People Who Behave Negatively to Their Owner
“Family Member, Best Friend, Child or ‘Just’ a Pet, Owners’ Relationship Perceptions and Consequences for Their Cats ”, Bouma et al 2021
“Exploratory Study of Cat Adoption in Families of Children With Autism: Impact on Children’s Social Skills and Anxiety ”, Carlisle et al 2020
“Toxoplasmosis: Recent Advances in Understanding the Link Between Infection and Host Behavior ”, Johnson & Johnson 2020b
Toxoplasmosis: Recent Advances in Understanding the Link Between Infection and Host Behavior
“The Role of Cat Eye Narrowing Movements in Cat-Human Communication ”, Humphrey et al 2020
The role of cat eye narrowing movements in cat-human communication
“Did We Find a Copycat? ‘Do As I Do’ in a Domestic Cat (Felis Catus) ”, Fugazza et al 2020
Did we find a copycat? ‘Do as I Do’ in a domestic cat (Felis catus)
“The Daytime Feeding Frequency Affects Appetite-Regulating Hormones, Amino Acids, Physical Activity, and Respiratory Quotient, but Not Energy Expenditure, in Adult Cats Fed Regimens for 21 Days ”, Camara et al 2020
“Taste Preferences and Diet Palatability in Cats ”, Pekel et al 2020
Taste preferences and diet palatability in cats :
View PDF:
“Not the Cat’s Meow? The Impact of Posing With Cats on Female Perceptions of Male Dateability ”, Kogan & Vlosche 2020
Not the Cat’s Meow? The Impact of Posing with Cats on Female Perceptions of Male Dateability
“Effectiveness of the Felixer Grooming Trap for the Control of Feral Cats: a Field Trial in Arid South Australia ”, Moseby et al 2020
Кошки-Мышки: Кто Нас Создал, И Во Что Нам Это Обошлось—Станислав Дробышевский, Drobyshevsky 2020
Кошки-мышки: кто нас создал, и во что нам это обошлось—Станислав Дробышевский
“The Relationship Between Neuroticism Facets, Conscientiousness, and Human Attachment to Pet Cats ”, Reevy & Delgado 2020b
The Relationship Between Neuroticism Facets, Conscientiousness, and Human Attachment to Pet Cats
“Body Size and Bite Force of Stray and Feral Cats ”, Fleming et al 2020
“The Small Home Ranges and Large Local Ecological Impacts of Pet Cats ”, Kays et al 2020
The small home ranges and large local ecological impacts of pet cats
“Where There Are Girls, There Are Cats ”, Li et al 2020b
“Cats, Once YouTube Stars, Are Now an ‘Emerging Audience’: They’re Addicted to Channels like Little Kitty & Family, Handsome Nature, and Videos for Your Cat—Provided Their Owners Switch on the IPad First ”, Lazzaro 2020
“Facial Expressions of Pain in Cats: the Development and Validation of a Feline Grimace Scale ”, Evangelista et al 2019
Facial expressions of pain in cats: the development and validation of a Feline Grimace Scale
“The Scavenging Patterns of Feral Cats on Human Remains in an Outdoor Setting ”, Garcia et al 2019
The Scavenging Patterns of Feral Cats on Human Remains in an Outdoor Setting
“Humans Can Identify Cats’ Affective States from Subtle Facial Expressions ”, Dawson et al 2019
Humans can identify cats’ affective states from subtle facial expressions
“Motion Illusions As Environmental Enrichment for Zoo Animals: A Preliminary Investigation on Lions (Panthera Leo) ”, Regaiolli et al 2019
“Attachment Bonds between Domestic Cats and Humans ”, Vitale et al 2019
“The Effect of a Hiding Box on Stress Levels and Body Weight in Dutch Shelter Cats; a Randomized Controlled Trial ”, Leij et al 2019
“Characterization of Plant Eating in Cats ”, Hart et al 2019
“Breed Differences of Heritable Behavior Traits in Cats ”, Salonen et al 2019
“A Review of the Development and Functions of Cat Play, With Future Research Considerations ”, Delgado & Hecht 2019
A review of the development and functions of cat play, with future research considerations
“Black Cat Bias: Prevalence and Predictors ”, Jones & Hart 2019
“Target Specificity of the Felixer Grooming "trap" ”, Read et al 2019
“Dogs Have Masters, Cats Have Staff: Consumers’ Psychological Ownership and Their Economic Valuation of Pets ”, Kirk 2019
View PDF:
“Intestinal Delta-6-Desaturase Activity Determines Host Range for Toxoplasma Sexual Reproduction ”, Genova et al 2019
Intestinal delta-6-desaturase activity determines host range for Toxoplasma sexual reproduction
“Jurassic Park: Starring My Cat [Velociraptors Kitchen Scene] ”, OwlKitty 2018
Jurassic Park: Starring my cat [Velociraptors kitchen scene]
“Cats Parallel Great Apes and Corvids in Motor Self-Regulation—Not Brain but Material Size Matters ”, Bobrowicz & Osvath 2018
Cats Parallel Great Apes and Corvids in Motor Self-Regulation—Not Brain but Material Size Matters
“The Socio-Cognitive Relationship between Cats and Humans—Companion Cats (Felis Catus) As Their Owners See Them ”, Pongrácz & Szapu 2018
“How Mammals Stay Healthy in Nature: the Evolution of Behaviors to Avoid Parasites and Pathogens ”, Hart & Hart 2018
How mammals stay healthy in nature: the evolution of behaviors to avoid parasites and pathogens
“Why Scientists Love to Study Dogs (And Often Ignore Cats) ”
“Perception of the Delboeuf Illusion by the Adult Domestic Cat (Felis Silvestris Catus) in Comparison With Other Mammals ”, Szenczi et al 2018
“Marijuana Intoxication in a Cat ”, Janeczek et al 2018
“Postmortem Scavenging of Human Remains by Domestic Cats ”, Suntirukpong et al 2017
“Effects of Latent Toxoplasmosis on Olfactory Functions of Men and Women ”, Flegr et al 2017
Effects of latent Toxoplasmosis on olfactory functions of men and women
“Use of Incidentally Encoded Memory from a Single Experience in Cats ”, Takagi et al 2017
Use of incidentally encoded memory from a single experience in cats
“Habitat Preference for Fire Scars by Feral Cats in Cape York Peninsula, Australia ”, McGregor et al 2017
Habitat preference for fire scars by feral cats in Cape York Peninsula, Australia
“Nature’s Balance #5 [The Cat Evolutionary Strategy] ”, Pereira 2016
“Impact of Macronutrient Composition and Palatability in Wet Diets on Food Selection in Cats ”, Salaun et al 2016
Impact of macronutrient composition and palatability in wet diets on food selection in cats
“We Went to NASA to Float on the World’s Flattest Floor: In a Warehouse in Alabama Is What May Be the Flattest Floor in the World—One That Can, in a Sense, Simulate Space. BBC Future—And Some Cats—Give It a Test Drive ”, Hollingham 2016
“Is Toxoplasma Gondii Infection Related to Brain and Behavior Impairments in Humans? Evidence from a Population-Representative Birth Cohort ”, Sugden et al 2016
“Chapter 11: Housing Cats in the Veterinary Practice ”, Rodan & Cannon 2016
“The Roles of Pet Dogs and Cats in Human Courtship and Dating ”, Gray et al 2015
The Roles of Pet Dogs and Cats in Human Courtship and Dating
“Emotion Regulation, Procrastination, and Watching Cat Videos Online: Who Watches Internet Cats, Why, and to What Effect? ”, Myrick 2015
“The Relationship Between Coat Color and Aggressive Behaviors in the Domestic Cat ”, Stelow et al 2015
The Relationship Between Coat Color and Aggressive Behaviors in the Domestic Cat
“What’s inside Your Cat’s Head? A Review of Cat (Felis Silvestris Catus) Cognition Research Past, Present and Future ”, Shreve & Udell 2015
“Stress in Owned Cats: Behavioral Changes & Welfare Implications ”, Amat et al 2015
Stress in owned cats: behavioral changes & welfare implications
“Audiogenic Reflex Seizures in Cats ”, Lowrie et al 2015
“Assessing Food Preferences in Dogs and Cats: A Review of the Current Methods ”, Tobie et al 2015
Assessing Food Preferences in Dogs and Cats: A Review of the Current Methods
“Feral Cats Are Better Killers in Open Habitats, Revealed by Animal-Borne Video ”, McGregor et al 2015
Feral Cats Are Better Killers in Open Habitats, Revealed by Animal-Borne Video
“Cats and Illusory Motion ”, Bååth et al 2014
“Executive Summary of Phase 3 of the Bayer Veterinary Care Usage Study ”, Volk et al 2014
Executive summary of phase 3 of the Bayer veterinary care usage study
“Are Cats (Felis Catus) from Multi-Cat Households More Stressed? Evidence from Assessment of Fecal Glucocorticoid Metabolite Analysis ”, Ramos et al 2013
“How to Make a Raptor Suit ”, Rosengrant 2012
“Chapter 11: Undesired Behavior in the Domestic Cat (The Behavior of the Domestic Cat, Second Edition) ”, Bradshaw et al 2012
“Chapter 12: Physiological and Pathological Causes of Behavioral Change (The Behavior of the Domestic Cat, Second Edition) ”, Bradshaw et al 2012
“Chapter 3: Mechanisms of Behavior (The Behavior of the Domestic Cat, Second Edition) ”, Bradshaw et al 2012
Chapter 3: Mechanisms of Behavior (The Behavior of the Domestic Cat, second edition) :
“Escape Behavior of Birds Provides Evidence of Predation Being Involved in Urbanization ”, Moslashller & Ibáñez-Álamo 2012
Escape behavior of birds provides evidence of predation being involved in urbanization :
View PDF:
“Human Perceptions of Coat Color As an Indicator of Domestic Cat Personality ”, Delgado et al 2012
Human Perceptions of Coat Color as an Indicator of Domestic Cat Personality
“Executive Summary of Phase 2 of the Bayer Veterinary Care Usage Study ”, Volk et al 2011
Executive summary of phase 2 of the Bayer veterinary care usage study
“The Search for Stability on Narrow Supports: an Experimental Study in Cats and Dogs ”, Gálvez-López et al 2011
The search for stability on narrow supports: an experimental study in cats and dogs :
View PDF:
“Geometric Analysis of Macronutrient Selection in the Adult Domestic Cat, Felis Catus ”, Hewson-Hughes et al 2011
Geometric analysis of macronutrient selection in the adult domestic cat, Felis catus
“Christopher Smart’s "Jubilate Agno" ”, Key 2011
“Breed Differences in Behavioral Response to Challenging Situations in Kittens ”, Marchei et al 2011
Breed differences in behavioral response to challenging situations in kittens :
View PDF:
“The Influence of Predation on Primate and Early Human Evolution: Impetus for Cooperation ”, Hart & Sussman 2011
The Influence of Predation on Primate and Early Human Evolution: Impetus for Cooperation
“Preferences for Infant Facial Features in Pet Dogs and Cats ”, Archer & Monton 2010
“The Cry Embedded within the Purr ”, McComb et al 2009
“The Taming of the Cat ”
View PDF:
“Why Do Dogs and Cats Eat Grass? (A) They Are Sick and Need to Vomit. (B) They Have a Dietary Deficiency. (C) Studies Point to a Third Option That May May Well Be the Correct Answer to This Often-Asked Client Question ”, Hart 2008
“Cat Vs Printer ”, gamook19 2008
“The Influence of Visual Stimulation on the Behavior of Cats Housed in a Rescue Shelter ”, Ellis & Wells 2008
The influence of visual stimulation on the behavior of cats housed in a rescue shelter
“Characterisation of Plant Eating in Dogs ”, Sueda et al 2008
“A Case of Recurrent Feline Idiopathic Cystitis: The Control of Clinical Signs With Behavior Therapy ”, Seawright et al 2008
A Case of Recurrent Feline Idiopathic Cystitis: The Control of Clinical Signs with Behavior Therapy :
View PDF:
“Jurassic Park: The Evolution of a Raptor Suit With John Rosengrant ”, Duncan 2006
Jurassic Park: The Evolution of a Raptor Suit with John Rosengrant
“Lion Attacks on Humans in Tanzania ”, Packer et al 2005
“A Comparative Study of the Use of Visual Communicative Signals in Interactions Between Dogs (Canis Familiaris) and Humans and Cats (Felis Catus) and Humans ”, Miklosi et al 2005
“Chapter 3: The Human-Cat Relationship ”, Bernstein 2005
Chapter 3: The Human-Cat Relationship :
View PDF:
“Perceptual and Acoustic Evidence for Species-Level Differences in Meow Vocalizations by Domestic Cats (Felis Catus) and African Wild Cats (Felis Silvestris Lybica) ”, Nicastro 2004
View PDF:
“Influence of Familiarity and Relatedness on Proximity and Allogrooming in Domestic Cats (Felis Catus) ”, Curtis et al 2003
“Validation of a Temperament Test for Domestic Cats ”, Siegford et al 2003
“Leopard Predation and Primate Evolution ”, Zuberbühler & Jenny 2002
“Object Play in Adult Domestic Cats: the Roles of Habituation and Disinhibition ”, Hall et al 2002
Object play in adult domestic cats: the roles of habituation and disinhibition
“Evidence Suggesting Pre-Adaptation to Domestication throughout the Small Felidae ”, Cameron-Beaumont et al 2002
Evidence suggesting pre-adaptation to domestication throughout the small Felidae
“Responses of Pet Cats to Being Held by an Unfamiliar Person, from Weaning to Three Years of Age ”, Lowe & Bradshaw 2002
Responses of pet cats to being held by an unfamiliar person, from weaning to three years of age
“Responses of Cats to Petting by Humans ”, Soennichsen & Chamove 2002
“Self-Induced Increase of Gut Motility and the Control of Parasitic Infections in Wild Chimpanzees ”, Huffman & Caton 2001
Self-induced Increase of Gut Motility and the Control of Parasitic Infections in Wild Chimpanzees
“Long-Term Follow up of the Effect of a Pheromone Therapy on Feline Spraying Behavior ”, Mills & White 2000
Long-term follow up of the effect of a pheromone therapy on feline spraying behavior
“Chapter 5: The Signaling Repertoire of the Domestic Cat and Its Undomesticated Relatives (The Domestic Cat: The Biology of Its Behavior) ”, Bradshaw & Cameron-Beaumont 2000
View PDF:
“Chapter 7: Density, Spatial Organisation and Reproductive Tactics in the Domestic Cat and Other Felids (The Domestic Cat: The Biology of Its Behavior) ”, Liberg et al 2000
View PDF:
“Chapter 10: The Human-Cat Relationship (The Domestic Cat: The Biology of Its Behavior) ”, Turner & Karsh 2000
Chapter 10: The human-cat relationship (The Domestic Cat: The Biology of Its Behavior) :
View PDF:
“The Ecology of Fear: Optimal Foraging, Game Theory, and Trophic Interactions ”, Brown et al 1999
The Ecology of Fear: Optimal Foraging, Game Theory, and Trophic Interactions
“Affiliative Behavior of Related and Unrelated Pairs of Cats in Catteries: a Preliminary Report ”, Bradshaw & Hall 1999b
Affiliative behavior of related and unrelated pairs of cats in catteries: a preliminary report
“The Social Bond between Man and Cat ”, Sandem & Braastad 1999
The social bond between man and cat :
View PDF:
“The Function of Allogrooming in Domestic Cats (Felis Silvestris Catus); a Study in a Group of Cats Living in Confinement ”, Bos 1998
View PDF:
“Visual and Tactile Communication in the Domestic Cat (Felis Silvestris Catus) and Undomesticated Small Felids ”, Cameron-Beaumont 1997
“Perceptual Cues That Permit Categorical Differentiation of Animal Species by Infants ”, Quinn & Eimas 1996
Perceptual Cues That Permit Categorical Differentiation of Animal Species by Infants
“Leaf-Swallowing by Chimpanzees: A Behavioral Adaptation for the Control of Strongyle Nematode Infections ”, Huffman et al 1996
“Factors Influencing the Reactions of Cats to Humans and Novel Objects ”, Ledger & O’Farrell 1996
Factors Influencing the Reactions of Cats to Humans and Novel Objects :
View PDF:
“Social Behavior of Domestic Cats ”, Voith & Borchelt 1996
Social Behavior of Domestic Cats :
View PDF:
“A Game of Cat and House: Spatial Patterns and Behavior of 14 Domestic Cats (Felis Catus) in the Home ”, Bernstein & Strack 1996
A Game of Cat and House: Spatial Patterns and Behavior of 14 Domestic Cats (Felis Catus) in the Home
“The Vomeronasal Organ of the Cat ”, Salazar et al 1996
“Development of Exclusivity in Perceptually Based Categories of Young Infants ”, Eimas et al 1994
Development of Exclusivity in Perceptually Based Categories of Young Infants
“Postmortem Injuries by Indoor Pets ”, Rossi et al 1994
“The Costs and Benefits of Predator Inspection Behavior in Thomson’s Gazelles ”, FitzGibbon 1994
The costs and benefits of predator inspection behavior in Thomson’s gazelles
“Methods of Scent Marking in the Domestic Cat ”, Feldman 1994
Methods of scent marking in the domestic cat :
View PDF:
“Predation on Primates: Ecological Patterns and Evolutionary Consequences ”, Isbell 1994
Predation on primates: Ecological patterns and evolutionary consequences
“Urinary Monitoring of Adrenal Responses to Psychological Stressors in Domestic and Nondomestic Felids ”, Carlstead et al 1992
View PDF:
“Effects of Early Rearing Experience on Subsequent Adult Sexual Behavior Using Domestic Cats (Felis Catus) As a Model for Exotic Small Felids ”, Mellen 1992
View PDF:
“Illusory Contour Orientation Discrimination in the Cat ”, Weerd et al 1990
“The Effects of Litter-Size Variation on the Development of Play Behavior in the Domestic Cat: Litters of One and Two ”, Mendl 1988
“Cats See Subjective Contours ”
“The Role of Vibrissae in Behavior: A Status Review ”, Ahl 1986
The role of vibrissae in behavior: A status review :
View PDF:
“Size-Dependent Predation on Rats (Rattus Norvegicus) by House Cats (Felis Catus) in an Urban Setting ”, Childs 1986
Size-dependent Predation on Rats (Rattus norvegicus) by House Cats (Felis catus) in an Urban Setting :
View PDF:
“Primal Self ”, Davis et al 1984
“Feeding Behavior in the Cat—Recent Advances ”, Thorne 1982
“The Curious Cat ”, Allaby & Crawford 1982
“The Effects of Social Isolation on the Behavior of Juvenile Domestic Cats ”, Guyot et al 1980
The effects of social isolation on the behavior of juvenile domestic cats
“External Influences on the Feeding of Carnivores ”, Mugford 1977
External Influences on the Feeding of Carnivores :
View PDF:
“Flavor Preferences in Cats (Felis Catus and Panthera Sp.) ”, Beauchamp et al 1977
“Chemocommunication among Domestic Cats, Mediated by the Olfactory and Vomeronasal Senses: I. Chemocommunication ”
View PDF:
“Taste of Water in the Cat: Effects on Sucrose Preference ”, Bartosuk et al 1971
“Cat Color Vision: Evidence for More Than One Cone Process ”, Daw & Pearlman 1970
“Maternal Influence in Learning by Observation in Kittens ”, Chesler 1969
Maternal Influence in Learning by Observation in Kittens :
View PDF:
“The Communal Organization of Solitary Mammals ”, Leyhausen 1969
“Observation Learning in Cats ”, John et al 1968
“What Children Fear ”, Maurer 1965
The Psychology of Learning, Revised Edition, Guthrie 1960
“Studies on the Basic Factors in Animal Fighting: VII. Inter-Species Coexistence in Mammals ”, Kuo 1960
Studies on the Basic Factors in Animal Fighting: VII. Inter-Species Coexistence in Mammals :
View PDF:
“Species Differences in Taste Preferences ”, Carpenter 1956
“Some Factors of Observational Learning in Cats ”, Adler 1955
Some Factors of Observational Learning in Cats :
View PDF:
“Sweet Taste in the Cat and the Taste-Spectrum ”, Frings 1951
“Observational Learning by Cats ”, Herbert & Harsh 1944
Observational Learning by Cats :
View PDF:
“Le Chat (The Cat) [Multiple Translations] ”, Baudelaire 1857
“Do Cats Have Intelligence/How Intelligent Are Cats? ”
“Do Cats Have Intelligence/How Intelligent Are Cats? § 2 ”
“Determining Cat Chirality ”
“Furiosa’s Cat Feeder: The Trick Is to Be Smarter Than the Animal With a Brain the Size of a Walnut ”
Furiosa’s Cat Feeder: The trick is to be smarter than the animal with a brain the size of a walnut
View External Link:
“Study: Prevalence of Pet Anxiety in the US, 2022 ”
“Whisker Fatigue in Cats: Causes, Symptoms, and Remedies ”
“Cat Meow Sounds Visualized As ACF Images ”
“How Well Can You Read Cat Faces? Test Yourself to See! This Short Quiz Contains 8 Video Clips of the Faces of Cats in Positive or Negative Emotional States (Selected from the 40 Videos Used in Our Recent Study). ”
“Dr John Bradshaw (Bristol Veterinary School) ”
“Another Study Shows That Feliway™ Doesn’t Work ”
“The Hidden Reason Processed Pet Foods Are so Addictive ”
“The Charles Mingus CAT-Alog for Toilet Training Your Cat [1954] ”
The Charles Mingus CAT-alog for Toilet Training Your Cat [1954]
“Gourmand Cat Fence ”
“More Wild Men’s Pulp Magazine Stories about Leopard Men and Leopard Women… ”
More wild men’s pulp magazine stories about Leopard Men and Leopard Women…
“Pets on Pot: The Newest Customer Base for Medical Marijuana ”
“I Can’t Give My Cat the Perfect Life. ‘TV for Cats’ Gives Her a Taste. ”
I Can’t Give My Cat the Perfect Life. ‘TV for Cats’ Gives Her a Taste.
“Petting Your Cat ”
“Researchers Put Little Hats on Cats to Measure Their Brainwaves ”
Researchers put little hats on cats to measure their brainwaves
View External Link:
“Non-Invasive Electroencephalography in Awake Cats: Feasibility and Application to Sensory Processing in Chronic Pain ”
“Morbid Attraction to Leopard Urine in Toxoplasma-Infected Chimpanzees ”
Morbid attraction to leopard urine in Toxoplasma-infected chimpanzees
“Japanese Researcher Publishes Study on Quality of Sleep When Pet Cats Choose Location of Slumber ”
Japanese Researcher Publishes Study on Quality of Sleep When Pet Cats Choose Location of Slumber
“In Search of the Heart of the Online Cat-Industrial Complex ”
“Layla ”, Meskhout 2026
“Cats, Rats, AI, Oh My! ”
“Cat + Tape = Experiment ”
“Campbell Pet Company’s ‘EZ Nabber’ ”
“Decerebrate Cat Walks and Exhibits Multiple Gait Patterns ”
Sort By Magic
Annotations sorted by machine learning into inferred 'tags'. This provides an alternative way to browse: instead of by date order, one can browse in topic order. The 'sorted' list has been automatically clustered into multiple sections & auto-labeled for easier browsing.
Beginning with the newest annotation, it uses the embedding of each annotation to attempt to create a list of nearest-neighbor annotations, creating a progression of topics. For more details, see the link.
feline-behavior
animal-relationships
pet-detection
Wikipedia (26)
Miscellaneous
/doc/cat/psychology/2024-bouma-figure7-catowneremotionguessesbyphoto.jpg/doc/cat/psychology/2024-graham-supplement-1-s2.0-S0168159123003131-mmc1.docxView Word document:
/doc/cat/psychology/2024-graham-supplement-1-s2.0-S0168159123003131-mmc1.docx/doc/cat/psychology/2024-pongracz-figure2-schematicofdifferentsizedcatopenings.jpg/doc/cat/psychology/2023-11-04-gwern-midjourneyv5-cat-linocutofblackcatshapedlikequestionmark.jpg/doc/cat/psychology/2023-11-04-jacobjanerka-cattryingtohideinapatchofgrassinthemiddleofamownlawn.jpg/doc/cat/psychology/2023-11-03-gwern-googleimages-catwindowbox-imagequilt.png/doc/cat/psychology/2023-11-03-gwern-midjourneyv5-anxiousblackcatatwindowsill-cropped-thumbnail.jpg/doc/cat/psychology/2023-11-03-gwern-midjourneyv5-anxiousblackcatatwindowsill.jpg/doc/cat/psychology/2021-04-17-henry-doesyourcatsbuttholereallytouchallthesurfacesinyourhome.html/doc/cat/psychology/2021-smith-figure4-catschoosingopticalillusions.jpg/doc/cat/psychology/2020-11-13-welcometomymemepage-catsascientificinventory.jpg/doc/cat/psychology/2019-vanderleij-figure2-weightlossinsheltercatsgivencatboxvscontrolcats.png/doc/cat/psychology/2017-vanhaaften.pdf:View PDF:
/doc/cat/psychology/2013-braden-henrilechatnoir-pg42-ineithercontrolmytailnorunderstandit.jpg/doc/cat/psychology/2008-casey.pdf:View PDF:
/doc/cat/psychology/2007-pozza.pdf:View PDF:
/doc/cat/psychology/2005-packer-figure2-farmerhutinfieldsvulnerabletolionssmashingintoeatthem.png/doc/cat/genetics/2004-say.pdf:View PDF:
/doc/cat/psychology/2003-nicastro.pdf:View PDF:
/doc/cat/psychology/1995-mccune.pdf:View PDF:
/doc/cat/psychology/1986-wilkinson.pdf:View PDF:
/doc/cat/genetics/1986-turner.pdf:View PDF:
/doc/cat/psychology/1977-mugford-figure9-catdietaryaversionlearning.png/doc/cat/psychology/1974-grastyan.pdf:View PDF:
/doc/cat/psychology/1967-collard.pdf:View PDF:
/doc/cat/psychology/1938-kuo.pdf:View PDF:
/doc/cat/psychology/1930-kuo.pdf:View PDF:
http://cdn2.discoverwildlife.com/british-wildlife/cats-and-wildlife-hunter-suburbiahttps://aeon.co/essays/why-keeping-a-pet-is-fundamentally-unethicalhttps://lareviewofbooks.org/article/the-pets-war-on-hilda-keans-the-great-cat-and-dog-massacre/https://www.amazon.com/Cat-Dancer-101-Interactive-Toy/dp/B0006N9I68https://www.cell.com/trends/ecology-evolution/fulltext/S0169-5347(20)30010-0https://www.frontiersin.org/articles/10.3389/fevo.2018.00146/fullhttps://www.frontiersin.org/journals/veterinary-science/articles/10.3389/fvets.2024.1403068/fullhttps://www.tiktok.com/@pageandwhisker/video/7099952695003467014https://www.vox.com/future-perfect/2023/4/11/23673393/pets-dogs-cats-animal-welfare-boredom
Bibliography
https://www.cell.com/iscience/fulltext/S2589-0042(24)02024-8: “Cats Are (Almost) Liquid!—Cats Selectively Rely on Body Size Awareness When Negotiating Short Openings ”,2024-green.pdf: “Is Companion Animal Loss Cat-Astrophic? Responses of Domestic Cats to the Loss of Another Companion Animal ”,2024-graham.pdf: “Too Much Too Soon? Risk Factors for Fear Behavior in Foster Kittens prior to Adoption ”,https://www.sciencedirect.com/science/article/pii/S0168159123003222: “Cat Owners’ Anthropomorphic Perceptions of Feline Emotions and Interpretation of Photographs ”,2023-mcgrath.pdf: “Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis ”,2023-scott.pdf: “Feline Faces: Unraveling the Social Function of Domestic Cat Facial Signals ”,https://www.frontiersin.org/journals/conservation-science/articles/10.3389/fcosc.2023.1157067/full: “Examining Leopard Attacks: Spatio-Temporal Clustering of Human Injuries and Deaths in Western Himalayas, India ”,2022-demouzon.pdf: “Discrimination of Cat-Directed Speech from Human-Directed Speech in a Population of Indoor Companion Cats (Felis Catus) ”,https://www.nature.com/articles/s41598-022-10261-5: “Cats Learn the Names of Their Friend Cats in Their Daily Lives ”,https://www.nature.com/articles/s41598-022-09694-9: “Mapping the ‘Catscape’ Formed by a Population of Pet Cats With Outdoor Access ”,2021-smith-2.pdf: “If I Fits I Sits: A Citizen Science Investigation into Illusory Contour Susceptibility in Domestic Cats (Felis Silvestris Catus) ”,2021-chijiiwa.pdf: “Cats (Felis Catus) Show No Avoidance of People Who Behave Negatively to Their Owner ”,https://www.nature.com/articles/s41598-020-73426-0: “The Role of Cat Eye Narrowing Movements in Cat-Human Communication ”,https://www.mdpi.com/2076-2615/10/6/1007: “Not the Cat’s Meow? The Impact of Posing With Cats on Female Perceptions of Male Dateability ”,2020-reevy-2.pdf: “The Relationship Between Neuroticism Facets, Conscientiousness, and Human Attachment to Pet Cats ”,https://www.wired.com/story/cats-watch-youtube/: “Cats, Once YouTube Stars, Are Now an ‘Emerging Audience’: They’re Addicted to Channels like Little Kitty & Family, Handsome Nature, and Videos for Your Cat—Provided Their Owners Switch on the IPad First ”,2018-pongracz.pdf: “The Socio-Cognitive Relationship between Cats and Humans—Companion Cats (Felis Catus) As Their Owners See Them ”,2015-gray.pdf: “The Roles of Pet Dogs and Cats in Human Courtship and Dating ”,2012-delgado.pdf: “Human Perceptions of Coat Color As an Indicator of Domestic Cat Personality ”,2011-hart.pdf: “The Influence of Predation on Primate and Early Human Evolution: Impetus for Cooperation ”,2005-miklosi.pdf: “A Comparative Study of the Use of Visual Communicative Signals in Interactions Between Dogs (Canis Familiaris) and Humans and Cats (Felis Catus) and Humans ”,2002-lowe.pdf: “Responses of Pet Cats to Being Held by an Unfamiliar Person, from Weaning to Three Years of Age ”,1996-bernstein.pdf: “A Game of Cat and House: Spatial Patterns and Behavior of 14 Domestic Cats (Felis Catus) in the Home ”,1969-leyhausen.pdf: “The Communal Organization of Solitary Mammals ”,