Cat Psychology & Domestication: Are We Good Owners?
Extended book review of Bradshaw 2013 (Cat Sense) on the connections between cat psychology, evolution/genetics, history of domestication or lack thereof, & possible dysgenics, highlighting modern maladaptivity of cat psychology, with key references; speculation on cat toys, knocking things over, and tails.
I review John Bradshaw’s book on domestic cat psychology, Cat Sense, after difficulties with my own cat.
Bradshaw reviews the history of domestic cats from their apparent Middle Eastern origins as a small solitary desert predator to their domestication in Ancient Egypt where breeding millions of cats for sacrifice may have played a critical role (as opposed to any unique role as a vermin exterminator) through to the modern day and psychological studies of the learning abilities and personalities of cats, with particular emphasis on cat social skills in “cat colonies” & plasticity in kittenhood.
As Bradshaw diagnoses it, these are responsible for what ability they have to modern pet life, even though they are not bred for this like dogs; every tame cat still has the feral cat in them, and are in many ways unsuited for contemporary living, with disturbing hints that human lack of selective breeding plus recent large-scale spay/neuter population control efforts may be producing a subtle dysgenic effect on domestication, and this double neglect & backfire may be responsible for disturbingly high rates of cat maladaptation & chronic stress diseases.
Cat researcher John Bradshaw’s book Cat Sense: How the New Feline Science Can Make You a Better Friend to Your Pet (201313ya) is a popularization of scientific research on domestic cat psychology, starting with its history & evolution. (Bradshaw has researched cats for decades, written a similar book on dogs called Dog Sense, and co-authored in 2016 with Ellis The Trainable Cat.)
While published in 201313ya, I regret to say that, unlike a human behavioral/population genetics book like Nicholas Wade’s 201412ya A Troublesome Inheritance (review) or David Reich’s 2018 Who We Are And How We Got Here, which were obsolete either before they were published or shortly thereafter1, Bradshaw’s book is, as far as I am aware, a useful overview of cat genetics & psychology research, such is the dormancy of the field. (I could only point to “Comparative analysis of the domestic cat genome reveals genetic signatures underlying feline biology and domestication”, Montague et al 201412ya or “The palaeogenetics of cat dispersal in the ancient world”, Ottoni et al 2017, as being relevant updates—also interesting in their own right.) Despite their overwhelming popularity as the aren’t researched much—cat pedigrees appear to be largely useless for heritability purposes (unlike dog pedigrees which are often analyzed), there is no equivalent of 23andMe or UKBB for cats the way there is for the dogs (Embark, which can do impressive research like Donner et al 2018 or Deane-Coe et al 2018), and large-scale dog breeding programs or experiments in dog cloning for military use or behavioral genetics experiments like Scott & Fuller’s Genetics and the Social Behavior of the Dog. Cat research being such a backwater, the sample sizes are absolutely tiny with scarcely any replication, and I’m sure that a decent fraction of what Bradshaw claims or speculates is wrong2, unfortunately, I don’t know which ones. We must do what we can what with we have.
Far From the Madding Crowd
I picked up Bradshaw for 2 reasons.
First, I’ve been interested in the catnip response for a while, curious how common it is, why it varies from country to country, and what alternatives there are, and thought Bradshaw might be useful.
The second was my cat.

My cat (2013–112024-10-12).
Back in 2017, my cat began having problems, urinating bloody urine and then not urinating at all; coming right before I was about to take a month-long trip and having some experience as a kid with the swiftly fatal consequences of a cat not urinating from my previous cat (which killed her on Christmas day, just to twist the knife), I rushed him back and forth to the vet’s, a task complicated by the fact that during the first trip he was so upset he urinated in the cat carrier and an urine sample couldn’t be obtained, but where the eventual diagnosis was “idiopathic urinary cystitis”3, temporarily patched by painkiller injections to allow urination, mostly caused by the standard dry cat food I fed him and fixed by never again feeding him dry food but wet cat food, and in helpfully specific advice founded no doubt on extensive empirical research, noted that the cystitis was possibly stress-exacerbated in some fashion or other (maybe by relatives visiting & the neighboring cat). Thankfully, switching in the prescription wet food “Crystal Diet” did the trick; in time, he rejected it, refusing to eat4, so I replaced it with regular wet food which is only somewhat more expensive (although eventually he began turning his nose up to some degree at that, preferring only the salmon pate, so eventually I gave up and began ordering only that5). I thought I was a good owner. Given how expensive and stressful the experience was for the both of us, I decided some insight into cat psychology was worth obtaining and Bradshaw came reasonably recommended.
Bradshaw, it turns out, does not once mention catnip or cat psychoactives. That was a little disappointing.
But he does have a lot of advice about cat psychology & communication & how to keep a cat sane. He emphasizes the degree to which a cat reacts to its environment and is stressed by it.
As an example of their sensitivity, he mentions (pg134) that cats will notice and investigate any changes in their environment. To test this claim, I began making small harmless changes while he was outside, such as moving a box or bowl to the side, and sure enough, upon jumping back through the cat flap, much of the time he would look around the room and immediately jump down to investigate the changed object. I was impressed how observant he turned out to be. I would never have noticed those changes.
Based on Bradshaw’s advice, I tried a number of things: I replaced a noisy box fan & put rubber vibration-absorbing pads on the bottoms of all the fans/air-filters/dehumidifiers/computers (unclear efficacy); I bought a Feliway cat pheromone diffuser spray (no apparent benefit and the Feliway-sponsored studies left me skeptical); I bought a large water bowl to encourage drinking and eventually began adding water to the wet food; moved his feeding station to a more hidden corner; I bought two ‘puzzle treat’ balls, simple and complex, to put dry food or treat bits in for him to play with (a big hit, although use must be strictly rationed to avoid triggering cystitis again, and the simple treat ball, which was an empty sphere, turned out to be far too easy to get treats out of6), and added on a ‘puzzle box’ which he also seemed to like; bought 2 ‘cat condos’ which are cubes similar to cat perches (which he frequently sleeps on although again I don’t know how much difference that makes); red/blue/purple/green laser pointers off eBay to supplement the wand (replaced by much superior wire wand toy) for playing chase (initially highly effective but he quickly lost interest & I think limitations of cat color vision may make some colors much less effective7); a Sphero Mini (cool toy but he remained afraid of it so after a year I gave it to my sister for her ferret); a replacement cat flap door (previous one was breaking down & jamming & sometimes he struggled to get in); “oat grass”/“wheat grass” seeds for growing oat/wheat shoots to nibble on8 (which he sometimes did but it wasn’t worth the trouble & I had problems with over-watering causing mold); bird seed for window-watching birds & squirrels (cheap & highly effective); freeze-dried chicken breast (expensive, only somewhat preferred to regular food & much less than “Greenies”, lamb liver & salmon failed); taurine supplement powder (failed); bought a large shelving unit with extra shelves in the hope that he would find it a useful hiding-place and would jump up to various levels (he sometimes sleeps at the bottom but my efforts to get him to experiment with higher levels failed); the vet, during the next visit which went poorly (as usual: Volk et al 2011/Volk et al 2014)9, gave me a 3-pill sample of gabapentin10 to try during relatives’ visits or future appointments (when I tried one dose, it made a little difference but not a lot, so I reserved the remaining 2 for the next vet visit, and 2×100mg turned out to be much more effective although the visit was still difficult for both fo us); and replaced the opaque cardboard/foam insulation around the cat-flap with an acrylic sheet from Lowe’s I cut to fit so he could more easily watch outside while laying on the window ledge. I also began periodically putting him in the cat carrier and carrying him around either by hand or in my car to try to gradually reduce his aversion to it. (I would never presume to leash a cat.) One particular success was using ‘videos-for-cats’: I had a hard time getting him to pay attention to the computer monitor long enough to realize that it was displaying videos of birds, but when I turned on the sound, he noticed and instantly became addicted (although this too eventually tolerated, and I had to start using it sparingly). Of these, the most worthwhile changes seem to be the wet cat food, puzzle treats, cat condos, bird seed, videos-for-cats and exposure therapy.
One case study matched him almost exactly, but most of the relevant solutions were inapplicable: he already has his own litter box, water bowl, food dish, apartment, and places to hide, and the outside was visible only from the cat perch & ledge. To do any better, I would have to eliminate visitors and nearby cats entirely—I can’t do much about those major stressors, unfortunately, and in fact another neighborhood cat has been coming around occasionally at night, which doesn’t help. But while he has taken a disliking to the litter box in favor of peeing in my bath tub, the cystitis has not repeated itself. I’ll take what I can get.
Egypt
The rank is but the guinea stamp,
And a cat’s a cat for a’ that.Gordon Stable, The Domestic Cat (1876150ya; after Burns, not Eliot)
One of Bradshaw’s most interesting points about domestication is the “out of Africa” hypothesis of cat evolutionary history—about them being relatively recently domesticated in Egypt (genetically supported by de Martin et al 2025). If wildcats are so untameable even adopted as kittens (as documented by case-studies like Mary Frances Pitt & Smithers & Tomkins’s attempts with Scottish wildcats), and we have not been domesticating cats ourselves, where does the original domestication come from? Whose seed-corn have we been eating?
He points to the dizzyingly long history of cats in Ancient Egypt—in few places other than ancient Egypt can authors so casually skip 1,000 or 2,000 years between examples—well displayed in Malek’s The Cat in Ancient Egypt illustrations, which I have since read & scanned, and does include the humorous cartoons of cats Bradshaw mentions. Cats back then were, apparently 15% larger than contemporary domestic cats (one of at least two anomalous changes in domestic cat sizes, the other being a “staggering and unexplained 70% reduction in bone-lengths…between the 11th & 14th centuries”), but more intriguing is the role of cats in Egyptian religion.
The common assumption I shared, that cats were naturals for domestication because they are such good vermin exterminators, is apparently not well-supported as there were many alternatives, some superior to cats in ways. Instead, Bradshaw suggests that the key to their domestication may be—and this is speculative, I should caution—their essentially arbitrary role as popular sacrifices, requiring countless ‘catteries’ attached to temples, and at least millions of sacrifices on a scale staggering to contemplate: “more than 4 million mummified ibis, a medium-sized wading bird that the Egyptians bred in captivity, were recovered from catacombs at Tuna el-Gebel, and an additional 1.5 million from Saqqara.” This is only the tip of a grisly iceberg:
We will never know how many cats were sacrificed this way. The archaeologists who discovered these sites wrote of vast heaps of white cat bones, and dust from disintegrating plaster and linen blowing across the desert. Several other cemeteries were excavated wholesale, and their contents ground up and used as fertilizer—some was used locally, some was exported. One shipment of cat mummies alone, sent to London, weighed 19 tons, out of which just one cat was removed and presented to the British Museum before the remainder were ground into powder. Out of the millions that were mummified, only a few hundred now survive in museums, and these come from a mere handful of the many cemeteries constructed over a period of several hundred years.
The iceberg becomes even more gruesomely impressive when you remember that cats are obligate carnivores (unable to be fed on non-meat products which lack the amino acids they have lost the ability to synthesize such as taurine which is vital for their health)11, and the Egyptian cat mummies were kept well-nourished & healthy right up to being carefully strangled, implying expensive meat consumption, and surprisingly to a cynic like myself, Bradshaw specifically notes “almost all the mummies that were produced to look like cats actually do contain a complete cat skeleton”. So:
The cat had rivals for the role of vermin exterminator: other carnivores of similar size were tamed, including various members of the weasel family, and the genet and its cousin the Egyptian mongoose…Very probably, cats did not have the edge as vermin controllers. The answer, therefore, must lie elsewhere, possibly in the cat’s biology. The connection between cats and religion is unlikely to have been crucial, since Egyptians sometimes venerated both mongoose and genet as well.
More likely, the cat managed to become more profoundly domesticated than any of its rivals. However, which was the cause and which the effect? Are cats more “trustworthy” and predictable than ferrets because they have evolved ways of communicating with humans, or is it the other way around? Since we do not know precisely how the domestic cat’s direct ancestors behaved, such questions are impossible to answer. Nevertheless, the cat’s capacity to evolve not only into a pest controller but also into a pet animal—its present-day roles—must have been central to its success in the first 2,000 years of its domestication. So what set the cat apart on its millennia-long journey into our homes?
Here, the cat’s involvement in Egyptian religion may well have been crucial. It is possible that the Egyptians’ veneration of cats that gave the cat the time required to evolve fully from wild hunter to domestic pet; otherwise, it might have remained a satellite of human society and not an intrinsic part. It is even possible that the factories that produced the cat mummies forced the evolution of cats that could tolerate being kept in confined spaces and in close proximity with other cats, both qualities that are signally absent from today’s strongly territorial wildcats but that are essential to life as an urban pet. Although of course most of the cats that carried the relevant genes died young—that was how they were being bred, after all—some must have escaped into the general population, where their descendants would have inherited an improved ability to deal with the close confines of urban society. Such changes take only a few decades in captive carnivores, as exemplified by the Russian fur-fox experiment that turned wild animals docile in just a few generations.
Is it possible that today’s apartment-dwelling cat owes its very adaptability to the inhabitants of those gruesome Egyptian catteries?
That is, the earliest cats which were tamed by humans starting somewhere around 9,000 years ago (given the population bottlenecks indicated by available genomes), were then merely one of many animals humans might associate with. But they were not truly domesticated: they were more like hand-reared wildcats. These basal cats were good enough to create a human-associated cat population which could gradually spread, but they couldn’t take on major roles, like the dog or horse. It was then the Egyptian period which did implicit selection on a set of highly-polygenic traits which would polish cats for social life with humans. Since we do not (yet) have polygenic scores for such traits, it is hard to prove or disprove this scenario—the easily observed population genetic history of cats would not reveal this soft selection, nor can we easily quantify any Egyptian influence nor even any trait differences across cat populations (any such difference could be post-Egyptian).12
Cats gradually spread post-Egypt, particularly by sea (leading to some interesting cases like islands of all-black cats due to founder effects), but without any signal events aside from an unfortunate period of persecution by the Catholic Church (itself anomalous inasmuch as cats were long popular with ecclesiastics) and occasional mistakes like 200,000 cats being killed because of London’s Great Plague of 1665–1666360ya.
At this point, Bradshaw turns from the history of cats, such as it is understood, to what sort of psychology we expect from a creature evolved for the cat niche, with its uniquely difficult nutritional needs, and then the practical implications of this psychology for cats as pets. Other reviews of Cat Sense complain that it is repetitive, which I didn’t really notice (there is a difference between being repetitive, and revisiting a central point from different angles) or that it focused too much on summarizing past research (a positive aspect for me) or Bradshaw’s research (write what you know, and such criticisms would be more convincing if they mentioned what key papers Bradshaw was neglecting in favor of his own), or that they already knew everything Bradshaw said and were deeply bored by it (in which case they must be far more expert on cats than I am and perhaps should be writing the papers themselves), or seem to be reading the wrong book entirely and should be reading the later The Trainable Cat.
More
Miscellaneous points I learned about cat psychology & biology:
the Greek for cat, aielouros, is literally “waving tail”; Egyptian girls were being named miw not long after miws started being pets (hence “catgirls” were present almost from the beginning)
long-haired cats are disadvantaged less by heat than by fur matting, causing infections/infestations
cat fur colors are something of a mystery; despite surprisingly complex genetics & some specific pleiotropic associations with traits like deafness, they appear to have little practical effect or known purpose:
despite stereotypes, correlations with aggressiveness are currently small & dubious13 (background)
cats appear to have no fur color preferences in mating
coat colors appear to be generally neutral in terms of fitness in the wild, as feral populations do not seem to change their colors markedly compared to the original cats (pg68)
coat colors also appear to be irrelevant to cats themselves:
What seems to be missing here is any trace of each cat’s own preferences. Although never studied directly, we have no evidence for “color prejudice” among cats. Tabby females do not seem to spurn black toms in favor of other tabbies: a white bib and socks seems to be neither an advantage nor a disadvantage when it comes to finding a mate, except perhaps indirectly, if the cat’s conspicuousness has resulted in it catching less prey and thus looking less healthy than its better-camouflaged rival. Whatever criteria cats use to choose a mate, coat color seems to be well down the list.
there is no known explanation for why black cats are so common, especially given that humans dislike black coats and black cats are seen as less friendly14
However, this continued prevalence of black cats, despite their disliked & easily-selected against phenotype, does imply that net human control over cat genetics is near-zero—perhaps because the cats we favor are immediately neutered and therefore we genetically destroy the cats we prefer (Clark 1975).
it would take ~31 years to make a cat-equivalent out of its shed fur
cats are “obligate carnivores”, unable, among other things, to make vitamin A or vitamin D or taurine and needing extra niacin & thiamine, and actually require meat/fat to make hormones to reproduce at all, while they can smell tomcat urine for the sulfuric ‘felinine’ to gauge hunting success.
Because of this, it is quite difficult to make a healthy vegetarian diet for a cat, and nutritionally-complete cat food apparently has been “widely available for only 35 years or so”. (I wonder how well urban cat’s-meat men compare?)
due to their desert descent, they have small water-efficient kidneys
This has unfortunate consequences like frequently developing kidney failure—and then succumbing to it within days. Or, cats can be killed by ordinary home pollutants like essential oils, exacerbated by their need to lick their fur clean (so they ingest aerosol or liquid poisons in much larger quantities than a dog would); even a single drop of Rogaine accidentally flicked onto their fur or residue on a pillowcase can hospitalize or kill a cat!
kittens have a much shorter window of plasticity than puppies, who can tolerate lack of human contact for up to seven weeks with any harm, but by that point, kittens have already been damaged.
By seven weeks, a kitten should already be learning play signals and mock fights and signals to stop playing (apparently, the ‘stop play’ signal is to “arch their back, curl their tail upward, and then leap off the ground”; I don’t think I’ve ever seen that one before). Similarly, kittens raised as litter-mates will get along closely, as indicated by things like grooming each other or laying touching another or happily eating side by side; while cats who met as adults will never, rarely, or never (respectively) do those behaviors no matter how cordial. And kittens raised with friendly dogs will be fine with dogs in the future, which is not something which could be said of all (or even most?) cats who encountered dogs as adults…
Cat research has publication problems. Of the plasticity window, Bradshaw then notes: “Remarkably, this revolutionary work has never been published in peer-reviewed journals; however, no one since has fundamentally disagreed with its conclusions.” On another occasion, “The late Penny Bernstein conducted a detailed study of stroking, details of which sadly remained unpublished when she died in 201214ya.” And Bradshaw himself omitted the key behavioral details from his 1999 cat dysgenics paper.
Cat research has issues with publishing & propagating knowledge—among catnip researchers, consider the ignorance of Villani 2011 or the never-published catnip GWAS.
the ‘scruffing reflex’ or ‘clipnosis’ is a quick (and amusing) way to immobilize a cat; I tested it myself on several cats. (My vet prefers to use a method of wrapping the whole cat tightly in a towel so they can’t see anything.)
Incidentally: Do male cats ever carry around kittens/other cats? Do females do this instinctively, or does it only happen because of motherhood leading to learning the behavior via trial-and-error? It occurs to me that I’ve never seen a spayed/neuter cat do it that I know of, either in person or via media; all the cats carrying around kittens are either mothers or I don’t know their history/status.
“cat flu” is one of the major killers of kittens, rather than starvation or accident, especially in cat colonies, and a perennial problem in animal shelters (getting in the way of good socialization)
Mother cats can’t/don’t recognize their young, and are perfectly happy to suckle a random kitten quietly slipped into their litter.
Apparently cuckoos are not a problem; anything which acts like a kitten gets milk. (This suggests that cat colonies are rare enough or genetically homogenous enough to not evolve strong offspring recognition skills as the occasional mistake doesn’t reduce inclusive fitness enough to matter—if all the queens in a cat colony are closely related, they might as well rear any kitten in their nest.)
This attitude may also be reflected in how mother cats will occasionally kill & eat one of their kittens. It is speculated this is to remove particularly weak kittens, avoid contagious disease, or recuperate from a particularly difficult pregnancy—as no one is bring the mother food and their physical reserves will be exhausted, risking the entire litter.15
in addition to the famous reflecting layer, cat eyes achieve night vision by having 10× fewer nerves, each nerve accounting for a larger bundle of rods spread further out, allowing greater sensitivity to dim light, at the cost of precision in bright light; they see only blue & yellow but even there appear bad at discriminating.
“Any other difference between objects—brightness, pattern, shape, or size—seems to matter more to cats than does color.” Peculiarly, lacking muscles to focus their eyes, they ‘scan’ objects instead, and Bradshaw suggests that “perhaps because it is just too much effort, they often don’t bother to focus at all”. The inability to see things nearby is presumably compensated by whiskers.
This farsightedness has a peculiar psychological consequence: cats appear to have a special memory system to memorize what is in front of them, in order to step over obstacles; if they haven’t stepped over it and are distracted, they then forget (and need to look around before they can start walking again), but if they have stepped over it, they automatically remember for the next 10 minutes and their hindlegs will automatically step over it. (A decerebrated cat can still walk, so there seems to be quite a bit going on in the rest of the feline nervous system.) I found that quite bemusing.
One thing Bradshaw doesn’t cover is how cats step in precisely the same place with their back paw as the front paw, which is called “direct registering” and is useful in quietly navigating cluttered environments; this explains why cats can jump on and off desks for years without knocking off a single thing—accidentally knocking things off would be shamefully dog-like. (Cats, of course, only knock things off intentionally.)
On the other hand, they can hear ultrasound and unusually low-frequency noises because of an unusual double-chambered chamber in their head, and localize even ultrasonic sounds—elegantly, if the ears’ repointing doesn’t work because of high frequencies, the chamber then starts to work. (This sensitivity to both ultrasound & low-frequency, exemplified by the “pspspspsps” cat call made famous by social media, might be why they are so freaked out by vacuum cleaners, canned air & air compressors, computer printers, and leaf-blowers: on the plus side, they know the instant a can is opened in the kitchen, but on the down side, they must involuntarily hear all sorts of ordinary metal or ceramic sounds… If cats designed the world, it would use more plastic.)
when showing a cat something interesting, like cat thyme leaves (a much rarer cat psychoactive), I’ve noticed them do an odd rictus grin to breath deeply; this turns out to be a way of invoking the vomeronasal organ for hormone smelling, called the Flehmen response. Primarily used in social situations, such as the cheek rubbing, which marks things with the glands in the cheeks. (If you’ve ever wondered why your cat likes rubbing its cheeks on you…)
cat toys simulate hunting, and boredom appears to reflect a combination of habituation and frustration. Changing color of a cat toy will restore interest, and being given a toy they can change or destroy also maintains interest.
Commercial toys do neither. Bradshaw notes that cats appear to be cautious around large toys, and never learn that they are in fact harmless, which matches my experience with trying to get him to play with the Sphero Mini, his great interest in the puzzle treats (getting a treat after fighting with it is isomorphic to hunting, after all, and eating the pellet definitely changes it), and with being able to restore his flagging interest in a laser pointer by switching to a different color. It seems like commercial cat toys may be suboptimal. (One honorable exception is the Ripple Rug, a 2-layer carpet, which is reminiscent of how cats play with things under sheets or behind curtains and which is inherently scrunchable & rearrangeable for novelty; the positive reviews of it describe it in ways which line up with this mutability theory of cat play, and it is striking how much cats love to hunt things moving inside it, like cat wands. The wire wand works exceptionally well with it.)
there are a bizarre number of possible cat hybrids: domestic cats can hybridize with a remarkable number of other species in Felidae, including South American cats with different chromosome counts (and the domestic cat × Geoffroy’s cat = ‘Safari’ cats are even fertile!)
cats can be trained, but it is difficult. (Tellingly, one often refers to ‘untrained’ or ‘poorly-trained dogs’, but never to an ‘untrained cat’. It is just assumed that cats will go along improvising regardless of how maladaptive a behavior is, and cannot be taught better.)
We should be careful to get out of an experience only the wisdom that is in it—and stop there; lest we be like the cat that sits down on a hot stove-lid. She will never sit down on a hot stove-lid again—and that is well; but also she will never sit down on a cold one anymore.
It is just harder: training & reinforcement are inherently ambiguous/under-determined16; unlike dogs, who can be trained with fairly sloppy mapping between action and reward, are eager to please, and are rewarded just by human praise, cats have no particular drive to please or human theory of mind. (People think that meows and other sounds are communication but as people are bad at classifying meows and cat owners are unable to interpret other cats’ sounds, the meows generally seem to represent an arbitrary language, or idiolect, learned by each cat by trial-and-error.17)
So training is hard: it requires food treats, must be trained backwards starting from the final step, and require very tight action/reward feedback—a reward must be provided within seconds. As it’s not easy to dispense a cat treat within seconds of an action, the easiest way to do this is clicker training: use a small gizmo which makes click sounds, and give them a treat every time you click it; after a while, the click itself becomes a reward, and it’s easy to make a click quickly, perhaps at a distance, delivering instant feedback.18
I found this useful to know for how to ‘train’ him but also for how to not train him to do things. One thing people often do with pets or small children is accidentally train them to do bad things. The pet/child wants something, makes trouble to get it, the person gives in and gives the thing, and one iteration of training has occurred. Dogs barking to get something is one I hear a lot, but cats can do it too—my grandparents have ‘trained’ their cat to wake them up at 6AM so he can go out. The problem, of course, is that they gave in too quickly, and he learned the lesson well. Now, when my cat tries out being a nuisance (to get some food, usually), and it’s a legitimate need, I avoid reinforcing him by deliberately waiting a few minutes until he’s given up and enough time has passed that then giving him whatever would not lead to any learning.19
the lack of trainability apparently has an exception, Bradshaw states: food can trigger learning of powerful associations even hours after consumption. This would make sense as an anti-bad-food defense, but unfortunately, this is yet another maladaptation in the modern context: “…this mechanism occasionally has unexpected consequences: a cat that succumbs to a virus may then go off its regular food even after it has recovered, because it has incorrectly associated the illness with the meal that happened to precede it.”20 21
people ascribe vague & indefinite mental powers to cats and think they are more intelligent than they are, simply because cats’ trial-and-error can go further than one thinks (example, or Charles Mingus noting a toilet-trained cat will learn to flush by accident as it does the ‘burying’ pawing motions & hits the toilet handle).
For example, mothers can teach kittens simply by interacting with an object, and then the kittens will spend time interacting with it too—not imitating her actions, just acting at random on their own—and may reinvent a reward (in the cited experiment, a food lever), while ignoring unrelated female cats. (I’ve long noticed that if I want a cat to learn something, putting them into the situation works better than trying to demonstrate it. To teach him to use the cat flap, I just shoved him through it several times in both directions. He got the idea.) I was amused to recall some instances of operant conditioning: for example, when I ran out of my original blue bottle of Purina tuna treats and happened to buy various other fish treats, he refused them all, including similar-seeming tuna treats; eventually I realized that it wasn’t the flavor that was the problem, the problem was that the treats were coming out of the wrong container! When I dumped them all into the blue bottle, he was happy to eat them all. I exploited this to train him to tolerate nail-clipping by starting with as little clipping as possible and reinforcing with treats within a second of letting go, and patiently expanding over a year to clipping all of his front claws before treats.
This use of trial-and-error fuzz testing leads to a signature blend of stupidity & genius familiar to anyone who has spent much time in statistics or AI or computer security—I was amused to think while reading Cat Sense that, as described, cats have all the strengths (& weaknesses) of contemporary AI research’s deep reinforcement learning (especially DQN): generalized, sample-inefficient, demonstrating the perverse genius of trial-and-error,
sleep()s all the time while blocking (the door), their poor exploration benefits from expert demonstrations, they are reward hackers (who optimize for getting the treat not what you wanted), hairy to train, black boxes, who are unable to generalize, solve short-term credit assignment problems only, are unable to model or plan, and overly-averse to states which were harmful without realizing which disentangled factor was responsible (cat/hot stove etc.), as Mark Twain put it (ch11 of Following the Equator, 1897129ya):22We should be careful to get out of an experience only the wisdom that is in it—and stop there; lest we be like the cat that sits down on a hot stove-lid. She will never sit down on a hot stove-lid again—and that is well; but also she will never sit down on a cold one any more.
This is the downside of being a ‘black box’ model-free DRL learner: by simply associating conditions with outcomes, they blame everything involved, which is simple and correct on average, but inefficient. I think of this every time I try to play with a new cat (eg. at an animal pound or cat cafe): I will introduce myself, and things will be going well… until a loud noise or movement elsewhere, unrelated to me, spooks the cat, and sometimes, renders my effort moot. “I was around, something bad happened, and that is that for that cat, too bad, try again next time.”
while cats have few abstractions or mental models of the world (and are merely very good at associations/trial-and-error)23, they do have mental maps as they can take physical shortcuts which go out of sight of a target or the ‘wrong’ direction for a while
cats are deeply inflexible about their territory and not adaptable like dogs, deeply anxious about establishing a territory and stopping other cats from entering their territory, and this appears to be a major cause of cat behavioral problems and disease like, incidentally, cystitis, and according to the UK Cat Protection, inability to get along is one of the most common reasons for a cat to be returned to their pounds. (This point made me think back to when I visited the animal pound and its ‘cat room’: festooned in cat trees and shelves and nooks and crannies, the ~20 cats there had all carefully arranged themselves equidistantly—which made it easy for me to play with each one separately, at least.)
Famous cat photographer Walter Chandoha needed to acclimate cats to his photography studio over days, and gingerly expose them to strobe lights, while his wife, a ‘cat whisperer’ coaxed the into relaxing & posing; Chandoha quit photographing cats after she died. (To highlight how severe the consequences of poor adaptation can be to both the cat and owner, I would have mentioned how frequently cat bites from even extremely friendly cats will send people24, including my grandmother, to the emergency room, due to the narrowness of cat fangs & ease of blood infection—which reminds me of the infamous Garfield comic, “Primal Self”) Maren Huck describes her informal observations of her ‘catcam’ research (Huck & Watson 2019):
Cats are seen as relatively lazy, especially compared to dogs. But we saw that when they were outside, they became superalert.25 They scanned their surroundings, sometimes for a half-hour or more on end. And even though cats are highly territorial, they didn’t always fight with other cats they encountered. Often, they just sat a couple of meters away from each other for up to a half an hour. They may have been sizing each other up. Sometimes they would engage in a greeting, briefly touching noses. When they were in their homes, the cats spent a lot of time following their humans around. They liked to be in the same room. A lot of my students were surprised at how attached cats were to people.
Bradshaw:
…cats’ emotional needs are still the cause of widespread misapprehensions. Cats are widely perceived as being far more socially adaptable than they actually are. Owners polled for a recent survey said that half of pet cats avoid (human) visitors to the house; almost all pet cats either get into fights with cats from neighboring houses, or avoid any contact with them; and half of the cats that share households with other cats either fight or avoid one another.1 Research confirms that cats find such conflicts highly stressful: they experience fear during the event itself, and anxiety in anticipation of the next encounter. They are constantly hypervigilant through cues we are unaware of, such as the odor of a rival cat. Chronic anxiety can lead to deteriorating health and may reduce life expectancy. Unfortunately, we do not know enough about how to mitigate this situation, made worse by the ever-increasing number of cats kept as pets.
…Simply replacing random-bred cats with cats from today’s pedigree breeds will not only perpetuate those genetic problems that already exist, it also cannot solve the problems that the cat is facing as a species. A reduced motivation to hunt and kill prey is just one of several factors that will enable cats to adapt better to twenty-first-century living. Allowing a little anthropomorphism: if cats could write themselves a wish list for self-improvement, a set of goals to allow them to adapt to the demands we place on them, it might look something like this:
To get along better with other cats, so that social encounters are no longer a source of anxiety.
To understand human behavior better, so that encounters with unfamiliar people no longer feel like a threat.
To overcome the compulsion to hunt even on a full stomach.
The corresponding requests from owners:
I’d like to have more than one cat at a time, and for my cats to be company—not just for me, but also for one another.
I wish my cat didn’t disappear into the bedroom to urinate on the carpet every time I have visitors.
I wish my cat didn’t bring gory “presents” through the cat-flap.
Suffering is all the more cruel when those suffering do not & cannot understand why.
A lot of otherwise-amusing cat behaviors look like hyper-active fear and danger responses. Consider the famous “cats and cucumbers” prank. (We may also underestimate dog fear/anxiety by thinking it funny.) This raises a good question of why do we like cats so much anyway…?
Cat territories do not need to be large: I’ve been surprised how rarely I see him venture far from home considering how much undeveloped area there is around my house which should be perfect for exploring/hunting, but small ranges are common for domestic cats (eg. Kays et al 2020), and being less than 91 meters is the usual even in natural areas, something like 10,000 times smaller than a wild or feral cat’s range, apparently without major psychological issue. (I’ve thought of getting a tracking collar because I am curious where he does go, but at >$120/year, I’m not that curious.)
Bradshaw muses of the tracking data from his own cat26 that:
Splodge rarely ventured beyond the trees—to my great relief, since there was a busy road not far beyond. He would sometimes remain in the same location for hours at a time, usually one of a few favored vantage points such as a branch of a fallen tree, before moving on to another site or returning home. He rarely seemed to be hunting: occasionally, he caught a mouse or a young rat, but would let birds fly past him without batting an eyelid. I often wondered, and still do, what was going through his mind as he maintained his surveillance of the same small area, day after day, year after year.
This seems strikingly connected to the lack of plasticity outside kittenhood and inability to befriend other cats as adults. (The tragedy of cats is their minds are as rigid as their bodies are limber.) But perhaps if cats are like humans, for whom anticipation is so often better than realization, then being safe while watching the world go by is a kind of heaven.
cats prefer their food & water bowls separated; this apparently was well-known among cat researchers (although I can’t find any good experiments) and is explained as an anti-fouling behavior.
I had somehow never heard of this! My family had always put out pairs of bowls for our cats just like our dogs, I’d always put out pairs for my cats & dogs, it seemed to work fine, the cats didn’t seem to mind…27 I tried separating them for my cat, and sure enough, he stopped dragging chunks of wet food away to eat and seemed to be eating more as well. I tested this further: I’d been adding water to his saucer of wet food because I was concerned he wasn’t drinking enough water & adding water is something some cat owners do, and the saucer sometimes wound up dry, so I thought it was working. But the separate-food/water claim suggests it was actually bad. So, I used the “two-bowl test”: I split his food into two saucers with half each and water/no-water, and put them down simultaneously (alternating left/right); out of 4 trials, he showed a strong preference for the no-water one—he always ate the no-water-added wet food saucer first and left the water-added saucer for eating only hours later (or not at all), dragging food away from the water one or licking the dry saucer instead. Thus, I stopped doing that too, and after a while, I replaced the bowl entirely with a separate motion-activated water fountain to provide ‘running water’—if I was wrong about the placement of the bowl being acceptable, then maybe I was wrong about the stillness of the water too.
I also read that cats often prefer their wet food microwaved briefly, which makes the smell much stronger. The smell is indeed overwhelming, but in 8⁄10 pairwise trials, my cat preferred the cold wet food he’d had for the past 4 years. (So it may well be true but his preferences are locked-in now.)
the coolest term in cat biology is “primordial pouch” (the baggy part of their stomach all cats have); the uncoolest is definitely “Flehmen response” (is that the facial expression you make when offered sauerkraut while watching men in Lederhosen play Glockenspiels?)
One undiscussed question: “What is it like to be a cat (tail)?”
I think it might be like something!
Why do cats pee in tubs/sinks? Particularly when stressed?
Those are bad places, because there’s no way to bury it, and they are clearly bothered by the odor. And they also clearly do not prefer bath tubs and sinks, or else they would use them regularly. (Cats do not use litter boxes to please humans despite disliking them, the way a dog might, and so stress might undermine their willpower; no willpower or training is necessary, they simply prefer litter boxes because they can follow their burying instinct.) Saying “it’s a habit” is not an answer, because that fails to explain why it would start, what reinforces it, and would be so consistent across cats. And if they are going to go outside their litterbox, why don’t they go anywhere at random, like on the floor or carpet? And if those aren’t good because they aren’t semi-enclosed or vaguely resemble a litterbox, why not use the actual litterbox?
My theory is that it’s “cold diuresis”, otherwise known as “why does walking barefoot on a cold bathroom floor suddenly make me need to pee?”
Defecation requires relaxation, which is difficult when severely stressed. Tubs and sinks are made of unusually thermally-conductive materials like enameled porcelain or aluminum, which, despite being room temperature, will feel much colder than more insulating materials like carpet or kitty litter. So a cat when stressed will not be able to go in its preferred litter box, and will eventually seek out a tub to walk on, triggering cold diuresis and defecation.
incidentally, here’s one I rediscovered myself (and may have solved): why do cats like human earwax so much?
Are Cats Domesticated?
Anyone who considers protocol unimportant has never dealt with a cat.
Robert Heinlein, The Cat Who Walks Through Walls
This is all well and good, but what I took away from Cat Sense, which I was not expecting, was a deeper appreciation of cat problems and a pessimism. Cats are not acceptable cats. They can be much better.
[Schopenhauer on cat humor. “We relate to this, for it is how we appear before the eyes of God.”28](/doc/psychology/novelty/2018-11-27-gwern-meme-cat-schopenhauer.jpg “A Schopenhauer portrait and quote from his Essays about the simple pleasures of watching animals solve the simpler problems of their lives which mirror ours, superimposed on a photo of a cat with its head stuck in a bottle.” alt=“‘What a peculiar pleasure it affords us to see any free animal looking after its own welfare unhindered, finding its food, or taking care of its young, or associating with others of its kind, and so on! This is exactly what ought to be and can be. Be it only a bird, I can look at it for some time with a feeling of pleasure; nay, a water-rat or a frog, and with still greater pleasure a hedgehog, a weasel, a roe, or a deer. The contemplation of animals delights us so much, principally because we see in them our own existence very much simplified.’ —Arthur Schopenhauer”){.float-right}
Bradshaw’s overall thesis is this: think of a cat as a small solitary desert ambush predator which happens to have some limited cognitive plasticity in kittenhood and some basic social skills enabling it to, on rare occasions, live in unstable ‘colonies’ of usually-related individuals focused around a rich food source; this desert predator happens to have become insinuated throughout human society but it has no real understanding of humans or “theory of mind” and to survive, relies heavily on what learning it manages about humans & other cats in that short window of plasticity, the simple social skills of a cat colony, trial-and-error, and treating humans as either dangerously unpredictable predators or large mother cats.
As pet cats are universally ‘fixed’, cat reproduction is now primarily done by those feral cats who are able to escape the traps and being neutered, with the most secretive surviving toms endlessly searching suburbia for the rare fertile female in heat. To be reproductively fit, a cat must always be able to survive on its own and evade humans, and remain hyper-alert to foreign cats or predators which might damage it (leaving it unable to hunt effectively on its own causing a downward spiral of starvation), sensitive to dangerous foods29 & places & people, passing up nutritious food if there’s even a small chance of being disablingly poisonous, and is unable to cope with too much novelty and may be entirely unable to understand humans or other cats if it was not properly acculturated as a kitten during its window of plasticity.
I notice that every time I see a cat doing something cool like riding a surf board, swimming in Hawaii, riding a human shoulder while biking, or in Kuo’s experiments growing up best buddies with mice or birds, it almost always turns out to be rooted in their kittenhood. So if you ever get a kitten, don’t waste the time—teach it something cool! (Or at least make sure to take it on car rides, eat a lot of different foods, and encounter strange dogs and humans.)
Bradshaw remarks that a cat raised only by humans, without experience with kittens, reacts to meeting another cat for the first time with “a bizarre combination of fascination and fear…Others…barely seem to realize they are cats at all…Hand-reared kittens may develop extreme personalities” (pg236; the word ‘fear’ comes up a lot in Cat Sense). This description reminded me of my neighbor’s cat, who was found as a tiny kitten in a cat nest of 5 kittens in a field by a farmer while mowing, and then adopted by them when the farmer took them to his vet. Thus, he was raised solely by humans & dogs; he is Maine Coon-ish, and friendly to humans & dogs30, and we often remark that “he seems to think he’s a human”, just as predicted. But he also reacted just as described by Bradshaw when I brought my own cat home, who seems to have been the first cat he ever encountered close up, and was an obsessive bully initially—years later, he still seems to both loathe & be fascinated by my cat31, while he is much less interested in dogs.
In other words, the reason “cats are cats everywhere” is because so-called domestic cats are barely domesticated.
Domestic cat admixture appears to contaminate ‘wild cat’ populations32 and vice versa, which aside from slowing any kind of domestication, also indicates the successful flow of ‘domestic’ cats back into the wild. We could also note that before the invention of cat litter in the 194779ya (yes, cat litter had to be invented!), keeping a cat indoors was challenging due to the awful stench of their urine & difficulty feeding them (where does one get all the meat if the cat is not hunting for itself and there are no cat’s-meat men?) and most people had outdoor cats, and farm cats were more tolerated than anything. Cats don’t exhibit a clear ‘domestication syndrome’ of small skulls, floppy ears, no longer going into heat, piebald coats, etc. (The domesticated foxes do; more obscurely, pet rats may too, with the “dumbo” mutation.) Dogs have been molded by humans to a far greater degree than cats, as we can see by comparing the range of dog breed traits to cats: there are no cat breeds which differ in size as much as, say, chihuahuas and St Bernards.33 Indeed, even mice may be more domesticated than cats—“today’s house mice rarely breed successfully away from human habitation, especially where there are wild competitors, such as wood mice”! They have no theory of mind, and won’t look to a human for help and training must be done with food rewards. A cat without any human contact before 10 weeks will be near-feral (except in the case of severe trauma, apparently, where it may bond with its rescuer, analogous perhaps with “hitting bottom”). This is better than true wild cats, where even fairly young kittens are aggressive and difficult to handle adults, but it is still indicative of deep fragility, dependent on just the right rearing environment else lapsing back to wild-type. (Puppies, in contrast, are more robust to lack of human experience.)
On a behavioral level, cats aren’t very domesticated compared to even, say, the Russian silver foxes. The behavioral assay for the foxes was whether they would eagerly approach a quiet human; after half a century, they all do and are very friendly. While anyone who has visited many people with cats knows that the modal reaction to a stranger in a house is to run away & hide until they’re gone (and Bradshaw cites a survey to that effect). While looking for a cat after my dog died, I visited the local animal shelter where most of the cats, perhaps a good 30, were all in a play room, and I spent an hour inside it, sitting & waiting for cats to decide to come to me; despite being the only person in the room the entire time (and the only person to adopt a cat that day)—suggesting that they were not exactly blessed with a surfeit of human-recreation opportunities, unlike the cats in the San Francisco cat cafe I visited in early 2018—of that 30+, only a handful did, and I had to approach them to get any impression. I eventually coaxed my future cat out of his hidey-hole to try him, upon which he was very friendly & starved for affection (but in retrospect should’ve been a warning sign to me that I was not picking a bold cat which was well-equipped to deal with the stresses of the modern world).
I also note that most people are bad at dealing with cats, making what should be clear errors (again, despite cats being the #1 or #2 most common pet in the world & so ignorance should not be a problem). You need to pet the cat in front of you, not the cat in your head, or else you may be bitten—yet I don’t know how many times I have seen someone try to touch a cat’s belly, start petting it with a full-body stroke rather than a chin or head scratch, insist on scratching them at the butt-tail point, interpret tail-lashing (the opposite of dogs, ‘tail wagging’ is a bad thing!), or ears pinned back as good things, try to pick them up, or startle them by abrupt untelegraphed movements. And it seems like ordinary common sense to me that when petting a cat, you should be polite: use one hand at a time (and if possible, bracing them with your other hand so they don’t have to offset you); let them see you and get their attention before starting; pay attention to what they like, as signaled by things like leaning into it; avoid pushing them at dangerous angles or into dangerous positions; pause when they yawn or lick themselves until they are done; etc. (I find that effective cat/dog petting advice also applies well to human massages.) Yet I could count (on one hand) how many people I see come into my local cat shelter who do a reasonable job of petting cats!
In contrast, while I have seen many people with poor dog manners (such as not presenting their hand to be sniffed or even people oblivious enough to attempt to pet a growling dog with teeth bared), people generally seem to make fewer mistakes, the dogs more clearly communicate with the humans, and the dogs tolerate the inevitable mistakes better (rather than running away or biting).
Apropos of vet visits & dogs vs cats, Kirk 2019 investigated the long-standing disparity in spending on cats & dogs’ care & medicine, and in her survey experiments, found that the ‘willingness to pay’ for dogs but not cats is not because owners just like dogs qua dogs but the difference is mediated largely by a sense of control34—which may sound bad (“human owners are power-mad narcissists!”) but makes perfect sense if we think about the point of this control. It would be irrational to try to take cats to the vet as often as a dog given that we can’t control them & the visit may be completely wasted. We need that control for their own good in a modern context.
So, ‘domesticated’ might not be the right word. Perhaps it would be more accurate to describe cats as ‘half-domesticated’, or merely, ‘tame’. (I increasingly think of cats as acting like small children—with PTSD & autism, especially given how much vets restraining cats by ‘squishing’ them under a blanket looks like weighted blankets. Or would schizoid personality disorder work better?)
Dysgenics

The cat status quo.
In Like Engend’ring Like, one of the definitions given of domestication is a creature whose reproduction is controlled by humans; Bradshaw points out that humans have never exercised control over cat reproduction anywhere like we do over dog or cow or sheep reproduction, and what control we did exercise (thereby selecting for domestication), we have wasted on cat-fancier fripperies & follies like coat colors, or forfeited by our otherwise-successful population control measures—abdicating cat reproduction to the worst possible cats, the cats so fearful and averse to humans that they are feral strays who can’t be caught (but which we feed lavishly anyway because when it comes to pets, we “love not wisely but too well”), creating what we might call ‘feline dysgenics’:
We must also ask whether the cat is being inadvertently and subtly altered by those who hold cat welfare closest to their hearts. Paradoxically, the drive to neuter as many cats as possible, with its laudable aim of reducing the suffering of unwanted kittens, may be gradually eliminating the characteristics of the very cats best suited to living in harmony with humankind: many of the cats that avoid neutering are those that are most suspicious of people and the best at hunting. The friendliest, most docile cats are nowadays neutered before leaving any descendants, while the wildest, meanest ferals are likely to escape the attention of cat rescuers and breed at will, thus pushing the cat’s evolution away from, rather than toward, better integration with human society.
…The tomcats must therefore roam as widely as possible, endlessly straining their senses for the yowl and odor of the rare female that is coming into season. Such toms are shadowy animals; some are theoretically “owned”—though their owners rarely see them—and many feral. Because they make themselves inconspicuous except when they have located a prize female, there are probably far more of them than most people realize. When it first became possible to obtain a cat’s DNA fingerprint from just a few hairs, my research team attempted to locate every litter born in homes in a couple of districts of Southampton, UK. From what we’d read, we expected to find that just a few “dominant” tomcats had sired most of the litters in each district; instead, we found that out of more than 70 kittens, virtually all litters had different fathers, only one of which we were able to locate.35
…the widespread adoption of early neutering by the most responsible cat owners risks pushing the domestic cat’s genetics back gradually toward the wild, away from their current domesticated state. A study that I conducted in 199927ya suggests that such extrapolation cannot be dismissed as science fiction.15 [See also Clark 1975.] In one area of Southampton (UK), we found that more than 98% of pet cat population had been neutered. So few kittens were being born that potential cat owners had to travel outside the city to obtain their cats. This situation had clearly existed for some time: from talking to the owners of the older cats, we calculated that the cat population in that area had last been self-sustaining some 10 years previously, in the late 1980s.
We located 10 female pets in the area that were still being allowed to breed and tested the temperament of their kittens after homing, when the kittens were 6 months old. Our hypothesis was that feral males must have fathered many of these kittens, since so few intact males were being kept as pets in the area, and all of these were young and unlikely to compete effectively with the more wily ferals. We found that on average, the kittens in those 10 litters were much less willing to settle on their owners’ laps than kittens born in another area of the city that still had a substantial number of undoctored pet tomcats. There was no systematic difference in the way these two groups of kittens had been socialized, and the mother cats in the two areas were indistinguishable in temperament. We therefore deduced that even if only one of the two parents comes from a long line of ferals, the kittens will be less easy to socialize than if both parents are pets. The study was too small to draw any firm conclusions, but in the years since it was carried out, blanket neutering has become more widespread, and so the cumulative effects of this on the temperament of kittens should be becoming more obvious. Neutering is an extremely powerful selection pressure, the effects of which have been given little consideration. At present, it is the only humane way of ensuring that there are as few unwanted cats as possible, and it is unlikely ever to become so widely adopted that the house cat population begins to shrink. However, over time it will likely have unintended consequences.
A similar set of observations is made about dogs as well, by Dawson et al 2019a.36
Where do cats come from? Given that we sterilize almost all our pet cats and hardly buy from cat breeders, pedigree or otherwise, they must come from somewhere.
I don’t know where my family’s two cats or my cat came from, beyond “the animal shelter”; my neighbor’s cat was definitely a feral cat’s offspring; my aunt’s cat was from a pet cat’s litter but almost certainly had an at least semi-feral father; on the other side of the family, my uncle’s farm cat was definitely a semi-feral cat tolerated for its assumed pest hunting; more pointedly, as far as I know, no one within two degrees of separation of me has ever bought a purebred or pedigreed cat, while I can offhandedly recall 10 purebred dogs (and counting) which were bought specifically from dog breeders and 3 or 4 of which were even registered. (I eventually asked my grandmother, “has anyone in our family ever bought a pedigree cat, or from a cat breeder at all?” She could think of no examples either over the last century, but agreed that there were at least a dozen dogs bought from breeders.) Those dogs definitely were not accidents or fathered by stray feral dogs. I do not know how much reproduction feral cats account for or how much de-domestication it is responsible for, but it does seem like it could be a lot, and could be enough to drastically slow any domesticating process or even reverse domestication. Bradshaw’s estimate of only 15% being “planned mating” (apparently inferred from ‘total cats − cat breeder sales’ estimates, which is, if anything, a loose upper bound as cat breeders do not necessarily breed for much or well) seems reasonable to me37, which allows great scope for bad effects. (Indeed, given the neutering & lack of breeding, how could there not be dysgenics?)
How would we know if cat domestication was reversing? Veterinary medical science has advanced enormously over the past century and spending on pet medical treatment increases even faster than human medical treatment (doubling since 200038) so we would not expect any clear long-term trend (perhaps the health gains are eaten by cat dysgenics), the environment has changed enormously (consider urbanization or the several-fold increase in suburban house sizes) which makes comparisons harder, and no one maintains systematic records of cat behavioral problems or health to do such comparisons in the first place. Pedigree cats are presumably immune if breeders are being honest and not enrolling half-stray matings as purebloods, and there is stabilizing selection for all pedigree cats in the sense that cat breeders will not breed or buy cats which cannot endure being transported to cat shows & sitting in a cage in the middle of thousands of cats for hours & being judged. (Are the ancient city cats of Istanbul, recently made famous by the 2016 documentary Kedi, so friendly to strangers because they are rarely neutered and to a considerable extent hand-fed by locals/tourists & do not subsist purely on hunting?)
So there should be a slowly growing gap over time—but no one is formally measuring pedigree cats against regular pet cats or feral ancestry admixture, and some pedigree cats are crazy themselves (eg. Siamese cats). And there are no large cat genetic datasets which could be examined to see if the domestication PGS has been decreasing recently or is lower than in ancient cat DNA (of which there is a smidgen).
We are now willing to put up with far more than our ancestors just a century ago will: only a monster would euthanize their fur-baby rather than spend $5k on medical treatment or therapy. (‘fur-baby’ here is not a joke and $5k is not a hypothetical but based on a real case: that is the total spending of my neighbor on her Labrador’s last 2 years, who had terminal cancer, whose treatment involved, among other things, amputating her leg to buy a few months; after she finally died, my neighbor was so distraught she was prescribed sedatives. And as mentioned, my aunt for years spent $1k a month on drugs for her dog, so the lifetime total there scarcely bears thinking on.)
So in other words, if cats were steadily de-domesticating and becoming sicker, between all the environmental interventions and additional spending & tolerance for crazy cats, the world would look… much as it does now.
What Is To Be Done?
The simple answer for feline dysgenics is to simply select the other way. There’s no canine equivalent because we control their reproduction and get all our dogs from either breeders or from domestic dogs being permitted to mate by lax owners, both of which inherently select against neurotic or unfriendly dogs; in most places in the West, there are no strays to speak of and they certainly don’t make up the overwhelming majority of reproduction. (Dogs have other genetic issues, largely stemming from recent population bottlenecks, which would benefit from better & more systematic breeding, but there is no threat of them de-domesticating.)
We are not trying to select on subtle or hidden traits here—it is clear to owners how fearful of strangers or affectionate a cat is, and those traits are definitely heritable (Braastad et al 1999, among others).
Bradshaw notes that one way to get started would be to more deliberately aim for “puppy cats”: choose an already highly domesticated breed, such as the Maine Coon or Burmese cat or Ragdoll/Ragamuffins, the last of which, perhaps because of pleiotropy or perhaps because Ragamuffin breeders say “The only extreme allowed in this breed is its friendly, sociable and intelligent nature”, are so friendly Bradshaw mentions they aren’t allowed outside (because they will be too naive & be attacked by other more aggressive/territorial/paranoid cats); another point in Ragamuffins’ favor is their many coat/eye colors, and their large size, which might be useful for fixing their kidney vulnerabilities. Another interesting possibility is to tap into the many feline hybrids, to greatly increase the amount of genetic diversity available to select on—probably more useful for health issues than domestication itself.
Pedigree cats sometimes have health problems39, but they appear unrelated to the domestication per se, and due to inbreeding & population bottlenecks (eg. Makino et al 2018; many pedigree breeds trace back to a handful of cats or just one cat), and limited use of more advanced breeding techniques like direct genetic testing; all of this could be avoided by starting with a large diverse founding population of a few hundred cats, and focusing their selection on the important things like health.
Another objection people raise against this is that they don’t want cats who are too “dog-like”. I sympathize with this and acknowledge that Ragamuffins might be too dog-like for many people, but I do not think that things like stressing oneself to death via cystitis or being terrified of strangers are intrinsic to cats’ appeal, nor do I think any owner actively desires those things, and it should be possible to improve social skills & plasticity & anxiety while preserving the things we value about cats, like their perennial curiosity, watchfulness, clever trial-and-error, enjoyment of playing chase, purring etc. without having to keep their problems like exploding kidneys or adult cats’ inability to befriend.

Jorge Luis Borges comments on cats and men.
Bradshaw is pessimistic that the cultural norm of getting cats for free and not paying for them like we do dogs will be impossible to break. How can high-quality cats outcompete ‘free’ kittens (even ones which are ticking time bombs)? How can we get people to see that there is any problem, or even that there might be a problem & we need to research cats more rather than leaving cat research the crumbs from dog research? While it may be difficult to change cultural patterns, it is not impossible: the social stigma among the middle/upper-class of buying from “puppy mills” did a number on them and successfully shifted the Western norm to buying either directly from the dog breeder when a specific breed is desired (eg. for hypoallergenic) or getting pets from the pound; admitting to peers that your new puppy was bought from a ‘puppy mill’ will earn one the stinging rebuke of glances askance, shuftis, and raised eyebrows. Many other practices were changed for reasons like their purported environmental friendliness, and I see no reason why one could not breed a better more domesticated cat which hunts less and, entirely truthfully, flip the environmentalist anti-cat narrative on its head. One could without much trouble work out how long a breeding program would take given the preliminary observed heritabilities and behavioral distributions (eg. for catnip response, I estimate it ought to take under 10 generations in the worst case of random initial selection of cats in order to make catnip response essentially universal, which since cats mature sexually at ~1y, means hardly a decade).
Rather, the problem is no one considers it a problem. Reading Cat Sense, I was repeatedly struck by a double-standard: “if cats were the size of large dogs and acted like normal cats do now40, they would be considered more dangerous than Rottweilers or Dobermanns and feared & outlawed” (indeed, many hybrids are outlawed in many places); “if a dog breed were as unhealthy, neurotic, unable to adapt, and stressed out by interaction to the point of routine life-threatening kidney failure, as normal cats are now, buying such a dog would be considered more immoral than buying a pug or English bulldog is now”; and so on. But because they are cats, it’s taken for granted and just the ‘catus quo’. (“Oh cats—isn’t it so funny how cats spend all that time staring out the window? Or won’t stay in the same room as the family dog? Or hide whenever someone visits? Or pee in your bed? Or bite you for no reason? Adorable!” No. No, not really.)
Overall, I learned much more than I expected from Cat Sense, and while much of it was not good news, some of it was useful, and I now find it easier to understand & forgive cats. I truly believe, that, in the strange artificial (often all too small) worlds in which they have been brought, so far from their ancestral land, filled with confusing clamorous clumsy giants, whether biting the hand that feeds them or lolling in the light or patiently observing, they, to the extent a breast filled with the furry heart of a small solitary desert predator little meant for such things can, love us. They are not at fault; we are.
Bibliography
Relevant cites in rough order of appearance in Cat Sense:
O’Brien & Johnson 200719ya, “The Evolution of Cats”
Driscoll et al 200917ya, “The Taming of the Cat”
Driscoll et al 200719ya, “The Near Eastern Origin of Cat Domestication”
Cameron-Beaumont et al 200224ya, “Evidence Suggesting Preadaptation to Domestication throughout the Small Felidae”
The Historical Library of Diodorus the Sicilian, Vol. 1, Chap. VI, trans. Booth 1814
Yurko 199036ya, “The Cat and Ancient Egypt”
von den Driesch & Boessneck 198343ya, “A Roman Cat Skeleton from Quseir on the Red Sea Coast”
Buckley et al 200422ya, “Complex Organic Chemical Balms of Pharaonic Animal Mummies”
Armitage & Clutton-Brock 198145ya, “A Radiological and Histological Investigation into the Mummification of Cats from Ancient Egypt”
Morrison-Scott 195274ya, “The Mummified Cats of Ancient Egypt”
Detry et al 201115ya, “The Emirate of Córdoba (756–929 AD) and the Introduction of the Egyptian Mongoose (Herpestes ichneumon) in Iberia: The Remains from Muge, Portugal”
Trut 199927ya, “Early Canid Domestication: The Farm-Fox Experiment”
“Pangur Ban”, translation by Eavan Boland
O’Connor 200719ya, “Wild or Domestic? Biometric Variation in the Cat Felis silvestris Schreber”
Todd 197749ya, “Cats and Commerce”
Ruiz-García & Alvarez 200818ya, “A Biogeographical Population Genetics Perspective of the Colonization of Cats in Latin America and Temporal Genetic Changes in Brazilian Cat Populations”
Ruiz-García 200026ya, “Is There Really Natural Selection Affecting the L Frequencies (Long Hair) in the Brazilian Cat Populations?” Zoran & Buffington 201115ya, “Effects of Nutrition Choices and Lifestyle Changes on the Well-being of Cats, a Carnivore that Has Moved Indoors”
Davis 193987ya, “Results of the self-selection of diets by young children”
Pozza et al 200818ya, “Pinch-induced Behavioral Inhibition (‘Clipnosis’) in Domestic Cats”
Bradshaw & Hall 199927ya, “Affiliative Behavior of Related and Unrelated Pairs of Cats in Catteries: A Preliminary Report”
Collard 196759ya, “Fear of Strangers and Play Behavior in Kittens with Varied Social Experience”
Casey & Bradshaw 200818ya, “The Effects of Additional Socialisation for Kittens in a Rescue Center on Their Behavior and Suitability as a Pet”
McVea & Pearson 200719ya, “Stepping of the Forelegs over Obstacles Establishes Long-lasting Memories in Cats”
Hughes et al 201016ya, “Predators Are Attracted to the Olfactory Signals of Prey”
Salazar et al 199630ya, “The Vomeronasal Organ of the Cat”
Pageat & Gaultier 200323ya, “Current Research in Canine and Feline Pheromones”
Bravo et al 198838ya, “Cats See Subjective Contours”; Wilkinson 198640ya, “Visual Texture Segmentation in Cats”
Hall et al 200224ya, [“Object Play in Adult Domestic Cats: The Roles of Habituation and Disinhibition”](#hall-et-al-2002}
Grastyán & Vereczkei 197452ya, “Effects of Spatial Separation of the Conditioned Signal from the Reinforcement: A Demonstration of the Conditioned Character of the Orienting Response or the Orientational Character of Conditioning”
Miklósi et al 200521ya, “A Comparative Study of the Use of Visual Communicative Signals in Interactions Between Dogs (Canis familiaris) and Humans and Cats (Felis catus) and Humans”
Thorndike 1898128ya, Animal Intelligence: An Experimental Study of the Associative Processes in Animals, Chapter 2
Seawright et al 200818ya, “A Case of Recurrent Feline Idiopathic Cystitis: The Control of Clinical Signs with Behavior Therapy”
Chesler 196957ya, “Maternal Influence in Learning by Observation in Kittens”
Herbert & Harsh 194482ya, “Observational Learning by Cats”
Curtis et al 200323ya, “Influence of Familiarity and Relatedness on Proximity and Allogrooming in Domestic Cats (Felis catus)”; van den Bos 199828ya, “The Function of Allogrooming in Domestic Cats (Felis silvestris catus): A Study in a Group of Cats Living in Confinement”
Say & Pontier 200422ya, “Spacing Pattern in a Social Group of Stray Cats: Effects on Male Reproductive Success”
Carlstead et al 199234ya, “Urinary Monitoring of Adrenal Responses to Psychological Stressors in Domestic and Nondomestic Felids”
“The late Penny Bernstein conducted a detailed study of stroking, details of which sadly remained unpublished when she died in 201214ya. For a summary, see Tracy Vogel’s ”Petting Your Cat—Something to Purr About”, and Bernstein’s own review, ”The Human-Cat Relationship”, in The Welfare of Cats, ed. Irene Rochlitz (Dordrecht, the Netherlands: Springer, 200521ya), 47–89”
Soennichsen & Chamove 200224ya, “Responses of Cats”
Nicastro 200422ya, “Perceptual and Acoustic Evidence for Species-level Differences in Meow Vocalizations by Domestic Cats (Felis catus) and African Wild Cats (Felis silvestris lybica)”
Lipinski et al 200818ya, “The Ascent of Cat Breeds: Genetic Evaluations of Breeds and Worldwide Random-bred Populations”
Braastad et al 199927ya, “Frequencies of Behavior Problems and Heritability of Behavior Traits in Breeds of Domestic Cat”; “The social bond between man and cat”, Sandem & Braastad 1999
Marchei et al 201115ya, “Breed Differences in Behavioral Response to Challenging Situations in Kittens”
Ledger & O’Farrell 199630ya, “Factors Influencing the Reactions of Cats to Humans and Novel Objects”
Geigy et al 200719ya, “Does a Pleiotropic Gene Explain Deafness and Blue Irises in White Cats?”
McCune 199531ya, “The Impact of Paternity and Early Socialisation on the Development of Cats’ Behavior to People and Novel Objects”
Lowe & Bradshaw 200224ya, “Responses of Pet Cats to Being Held by an Unfamiliar Person, from Weaning to Three Years of Age”
Mellen 199234ya, “Effects of Early Rearing Experience on Subsequent Adult Sexual Behavior Using Domestic Cats (Felis catus) as a Model for Exotic Small Felids”
“B. J. Karl and H. A. Best, ”Feral Cats on Stewart Island: Their Foods, and Their Effects on Kakapo”, New Zealand Journal of Zoology 9 (198244ya): 287–93. Despite this study, the cats on Stewart Island were subsequently exterminated, but (as predicted from the study) the kakapo continued to decline, and eventually scientists moved all the survivors to another, predator-free island.”
Lilith et al 201016ya, “Do Cat Restrictions Lead to Increased Species Diversity or Abundance of Small and Medium-sized Mammals in Remnant Urban Bushland?”
Fair 201016ya, “The Hunter of Suburbia”
Loss et al 201313ya, “The Impact of Free-ranging Domestic Cats on Wildlife of the United States”
Baker et al 200818ya, “Cats about Town: Is Predation by Free-ranging Pet Cats Felis catus Likely to Affect Urban Bird Populations?”
Møller & Ibáñez-Álamo 201214ya, “Escape Behavior of Birds Provides Evidence of Predation Being Involved in Urbanization”
Childs 198640ya, “Size-dependent Predation on Rats (Rattus norvegicus) by House Cats (Felis catus) in an Urban Setting”
The Governing Council of the Cat Fancy 201214ya, “The Story of the Ragamuffin Cat”
Connolly 200323ya, “Bengals as Pets”
Saulny 200422ya, “What’s Up, Pussycat? Whoa!”
Bradshaw et al 199927ya, “Feral Cats: Their Role in the Population Dynamics of Felis catus”
Allaby & Crawford 198244ya, The Curious Cat
Smithers 196858ya, “Cat of the Pharaohs: The African Wild Cat from Past to Present” (account of raising pet African wild cats)
The Domestic Cat: The Biology of Its Behavior, 2nd ed, ed Turner & Bateson 200026ya (ISBN: 0-521-63648-5)
chapter 4, “Individuality in the Domestic Cat: Origins, Development and Stability”, Mendl & Harcourt 2000
chapter 5, “The Signaling Repertoire of the Domestic Cat and Its Undomesticated Relatives”, Bradshaw & Cameron-Beaumont 2000
chapter 7, “Density, spatial organisation and reproductive tactics in the domestic cat and other felids”, Liberg et al 2000
chapter 10, “The human-cat relationship”, Turner & Karsh 2000
The Behavior of the Domestic Cat, 2nd ed, Bradshaw et al 201214ya (ISBN: 1780641206)
Further reading:
McComb et al 200917ya, “The cry embedded within the purr”
Delgado & Hecht 2019, “A Review of the Development and Functions of Cat Play, and Future Research Considerations”
Dawson et al 2019b, “Humans can identify cats’ affective states from subtle facial expressions” (they can, but most are quite bad at it; demo quiz); “Facial expressions of pain in cats: the development and validation of a Feline Grimace Scale”, Evangelista et al 2019; “Evolution of facial muscle anatomy in dogs”, Kaminski et al 2019 (easier with dogs because of selection for facial expressive capability?)
Humphrey et al 2020, “The role of cat eye narrowing movements in cat-human communication”
Fugazza et al 2020, “Did we find a copycat? ‘Do as I Do’ in a domestic cat (Felis catus)”; “Assessing cats’ (Felis catus) sensitivity to human pointing gestures”, Maeses & Wascher 2022
Krajcarz et al 2020, “Ancestors of domestic cats in Neolithic Central Europe: Isotopic evidence of a synanthropic diet”
External Links
“Cats rival dogs on many tests of social smarts. But is anyone brave enough to study them?”; “Attachment bonds between domestic cats and humans”, Vitale et al 2019; “The Family Dog Is in Sync With Your Kids: Dogs orient and move in synchrony with family members, which may have implications for the emotional development of people and pets”
“22 priceless photos of cats trying to hide from the vet” (not actually amusing)
“Audiogenic reflex seizures in cats”, Lowrie et al 2016 (troubling)
“Where there are girls, there are cats”, Li et al 2020
“Against Dog Ownership”, Matt Lakeman
“Does Your Cat’s Butthole Really Touch All The Surfaces In Your Home?”, Henry 2021 (thankfully, no)
“Gourmand Cat Fence” (Raspberry Pi for water spray to keep cat away from eating plants & barfing)
“Your Dog is Even Smarter Than You Think” (on amateur experiments in cat/dog language capabilities)
Discussion: Reddit

Here is another photo of my cat, just because I like it; it reminds me of Gerard Manley Hopkins’s poem “Pied Beauty”.
Appendix
Fuzz Testing
Toys
“Object play in adult domestic cats: the roles of habituation and disinhibition”, Hall et al 2002
Cat Architecture
Particularly striking in Reich’s case as his book sent population geneticists into a frenzy by revealing unpublished secrets of the Reich lab, but such is the pace of ancient human genetics research 2010–102020 that by 2019, it was already… ancient history.↩︎
An example: catnip-response was a Mendelian dominant genetic trait for 50 years, based on a cursory analysis of a few dozen cats in a single paper back in the 1960s, until a grad student compiled a real sample of a few hundred cats (bonus nominative determinism: the graduate student in question worked at the lab of Leslie Lyons) to check with more plausible contemporary genetic models, and found catnip-response is just an ordinary liability threshold polygenic trait.↩︎
Where ‘urinary’ means ‘pee’, ‘cystitis’ mean ‘swollen bladder’, and ‘idiopathic’ means ‘dunno why’.↩︎
Given Bradshaw’s comment about cats going off their feed due to misattributing a health issue to the food they eat, I wonder if there was a hidden recurrence of cystitis?↩︎
To rant a little about this topic: Purina’s salmon pate turns out to be oddly hard to get at a reasonable price, despite being included in their standard “Seafood Variety” pack.
I can buy the seafood variety pack locally no problem, but not an all-salmon pate. Online, all-salmon packs exist but are easily 2–3x the cost—unacceptable.
Finally, after a good deal of hunting online for alternatives, I found Petco.com offered them (batches of solely salmon pate) at hardly a 15% markup and as a monthly subscription as well—perfect! I was pleased with myself. I signed up, set up a subscription, and got a shipment once a month with no additional effort, my cat was much happier, less food was wasted, and it cost about the same. And it did indeed work perfectly. For about 3 months.
You know what Petco decided to do? They banned all Purina products from their store, on the grounds of banning “all dog and cat food and treats that contain artificial ingredients”. So instead they shipped me a package of ‘organic’ salmon pate which cost like 50% more and my cat instantly hated and would eat only after starving overnight. (Yeah, screw you and your virtue-signaling pseudo-science bullshit too, Petco. Is there even a single real study demonstrating all-cause mortality changes? I doubt it. And you know what’s worse for my cat than ‘artificial ingredients’? Eating food he hates.)
So after all that, it wound up being an almost total waste of time: I then had to go and cancel, and find some alternative. I haven’t found any alternatives, so as of June 2019, I simply go to my local Walmart and buying every single salmon pate they have in stock.↩︎
Concerningly, Cecchetti et al 2021 finds that using puzzle feeders to provide all a cat’s food (as opposed to treats), was the only intervention (out of 5 interventions) to actually increase wildlife predation. This suggests that there is a limit to how much puzzling/hunting a cat wants to do, beyond which is stressful and hunger-inducing. (Perhaps because cats are unusually lazy?)↩︎
Judging from descriptions, probably a blue or purple laser pointer is best. I did get a purple one, but it was not as bright as the others and less reliable. Bradshaw notes that in exchange for the loss of color, cats appear much more attuned to shapes—so perhaps what laser pointers need is to be able to change the shape of the dot, with a rotating filter/cutout?↩︎
Why do cats & dogs eat grass or other plants, and occasionally barf? (My cat does this so regularly that I keep an eye out when I note him eating grass outside, lest he barf on my keyboard/monitor from his perch.) Are they sick, or their diet nutritionally-deficient? The best theory so far is that it’s simply a parasite prophylactic: leaves & grass help physically push any intestinal worms out.
See “Leaf-Swallowing by Chimpanzees: A Behavioral Adaptation for the Control of Strongyle Nematode Infections”, Huffman et al 199630ya/“Self-induced Increase of Gut Motility and the Control of Parasitic Infections in Wild Chimpanzees”, Huffman & Caton 200125ya; “Characterisation of plant eating in dogs”, Sueda et al 200818ya/“’Why do dogs and cats eat grass?”, Hart 200818ya; “Characterization of plant eating in cats”, Hart et al 2019; “How mammals stay healthy in nature: the evolution of behaviors to avoid parasites and pathogens”, Hart & Hart 2018. (Yoshimura et al 2020 tests out a rival explanation for plant-eating, that it helps expel hairballs, and finds little relevant correlation in snow leopards.)↩︎
A (apocryphal?) veterinary medicine class handout summarizes cat handling for vets:
↩︎The cat is faster and has sharper teeth and nails than you do. It has no ‘code of ethics’ or considerations for its own future. In a fair fight it will win.
DON’T FIGHT A CAT
USE YOUR BRAIN
USE DRUGS
Suggestions to use gabapentin on cats appear to be based on van Haaften et al 2018 where the gabapentin reduced a mean “fearful” response to merely “very tense”, although I was particularly struck by how they note—which apparently is just as expected to them & merely a detail—that a fifth of the pet cats could not be examined by the vet without being drugged, so traumatizing is the experience:
The veterinarian was able to complete the physical examination on at least 1 visit for 19 of the 20 cats. One cat could not be removed from the carrier after either treatment because of aggression. For 4 cats after placebo administration, the examination could not be completed; however, after gabapentin administration, the examination could be completed.
I and my relatives had long noted that my cat seemed afraid of strange women much more than strange men, and speculated that he had been abused by a previous female owner before I adopted him. After a few vet trips, I came up with an alternate explanation: he feared women because the staff at the vet clinics we went to happened to be ~100% women.
I once asked someone who cloned their cat what the biggest difference was. He said that the clone was much more trusting & gentle than the original (bought from cat breeders) had been, particularly of women. He attributed this to the clone’s initial rearing, saying that the Viagen cat cloning facility in upstate New York had MIT interns & staff who loved the cats, and hand-fed & played with them as kittens—even going so far as to set up a lottery for who would take the clone home if he refused to take it. (Which interestingly seems to imply that Viagen does not have an excess of cat clones, and that is why people cloning cats do not get the buy-1-get-1-free offers that people cloning their dog often receive.) I noted that such staff would almost certainly be much more gender-balanced, and so the cat probably would not learn to fear women.↩︎
Bradshaw only briefly mentions taurine as a vital nutrient for cats, who have unusual metabolic demand for it and can’t synthesize it—in fact, it seems cats can’t even taste taurine. (Presumably, because taurine is so uniformly in raw meat/bodies and they are hypercarnivores, there is no point.)
Pottenger’s cats strikingly demonstrate the long-term consequences of chronic taurine deficiency. Dismayingly, it seems that in the transition from foraging & table scraps & cat’s-meat-men to commercial pet food, for decades the taurine was unwittingly destroyed by the processing, particularly boiling. (Cat’s-meat-men apparently had varying practices: some boiled the horse meat for at least 2 hours, while others sold raw meat. Given that taurine is such a chronic deficiency and cats would eat other food, I don’t know what the net outcome would be back then.) This would cause blindness & lethal heart disease, among other issues. The current taurine supplementation used for commercial cat food was set by relatively small studies focused on gross health issues & taurine excretion (eg. Burger & Barnett 1982), and it’s not clear that these are optimal levels. Worryingly, there may be individual differences in taurine requirements due to the cat microbiome, of all things.
Overall, the taurine literature left me worried that we continue to under-dose taurine. I bought some taurine bulk powder supplement in late 2023 to try feeding to my cat to see if I noticed any major changes, but—cats being cats—he seems to greatly dislike the powder, even mixed into his wet food. (I specifically bought an “unflavored” taurine powder, reasoning that if cats can’t taste taurine directly, it should be impossible for him to notice it being added to his wet food; but no dice, so I had to use it up myself. Concerned by his low appetite in September 2024, I tried a cat-specialized taurine supplement, a daily multi-vitamin chewable in September 2024, which he also rejected, but this was not the chewables’ fault, as the low-appetite turned out to be a symptom of terminal cancer.)↩︎
An analogy here would be the Russian silver fox breeding program. It used foxes trapped decades before and raised for fur; those foxes were undomesticated, until the breeding program began. One could easily detect that the fox population in question had been founded a long time ago, but without genes linked to aggression/tameness, one would struggle to show what, if any, selection happened after the captive breeding population was created.↩︎
Bradshaw suggests (pg226), on the strength of Ledger & O’Farrell 1996 (which is however very weak), that there may be correlations within extremely-inbred species due to founder effects, like a male with a bad temperament & particular coat color.↩︎
Perhaps related to emotion reading: Jones & Hart 2019 finds subjects who rate black cat photos as being hard to emotionally read also rate them as being less friendly & more aggressive, and less ‘adoptable’.↩︎
One thought: if cats were human-level intelligent and had feline civilizations, would they still eat kittens? If so, how would they regard it and talk about it and conceptualize infanticide? Indeed, given their apparent laissez-faire attitude towards kittens, how would human-level mother cats think about kittens/children in general?↩︎
Suppose I come across him peeing in my bath tub and spritz him with a spray I have in the bathroom. What would he learn? Gregory Bateson poses a similar question (Steps to an Ecology of Mind):
A certain mother habitually rewards her small son with ice cream after he eats his spinach. What additional information would you need to be able to predict whether the child will:
Come to love or hate spinach,
Love or hate ice cream, or
Love or hate Mother?
If I spritzed him would he learn to: fear & avoid the spray bottle, fear & avoid the bath tub, fear & avoid the bathroom, fear & avoid me, fear & avoid urinating—or all of the above?↩︎
Bradshaw, pg140, citing Nicastro & 200323ya:
Cats need to meow because we humans are generally so unobservant. Cats constantly monitor their surroundings (except when they’re asleep, of course) but we often fix our gaze on newspapers and books, TVs and computer screens. We do, however, reliably look up when we hear something unusual, and cats quickly learn that a meow will grab our attention. For a few cats this may be rewarding in itself, but the meow will often also produce the reaction that the cat is hoping for, such as a bowl of food or an opened door. Some cats then shape their own behavior to increase the precision of their request. Some will deliver the meow at specific locations—by the door means “Let me out”, and in the middle of the kitchen means “Feed me.” Others find that different intonations lead to different results, and so “train” themselves to produce a whole range of different meows. These are generally different for every cat, and can be reliably interpreted only by the cat’s owner, showing that each meow is an arbitrary, learned, attention-seeking sound rather than some universal cat-human “language.”13 Thus, a secret code of meows and other vocalizations develops between each cat and its owner, unique to that cat alone and meaning little to outsiders.
One could note something similar of cats walking in front of people: some owners will not stop or go around, and some will, and so cats will be trained differently.↩︎
I tried but failed with clicker training for getting him into his cat carrier. (He is not a smart cat.) Now I just try to trick him into it with treats.↩︎
By consistency, I have also taught him to voluntarily ‘trade’ with me in two ways.
Brushing/clipping him was initially difficult. So I began using treats. Whenever I want to brush or clip, I hold up the tool & treats and shake them; he gets the treats only if he comes to me and allows himself to be cleaned—if he doesn’t come, then after a minute, I put them away. He has learned that cooperation → treats, and he sits to stare at the treats trying to gauge whether he wants them enough that day. (About a fifth the time he does not, and, marshmallow-style, deliberately turns away to avoid looking at the treats he won’t be getting; I know he’s on the brink if I spot any drool.) Sometimes if he is uninterested, I will ‘raise my bid’ by slowly dropping treats on the ground, one by one, stopping if I would have to overfeed him.
I’ve done the same thing with coming in through the cat flap at night: I don’t simply close the cat flap & give him food/treats (unless it is very late at night & I must close it), I very stereotypically stand by it holding it and ask him the same thing each time: “Done for the night?” He will then usually jump up to stick his head outside to see if he wants to go outside one last time—again visibly thinking and looking back & forth outside & inside—and either go out or then jump down and head to the food bowl. (If he is procrastinating at the cat-flap, choosing neither in nor out, I will ask him again and then start petting him, escalating to scratching his tail-butt.) Often at night, he will jump in through the cat-flap and come bother me in a distinct way until I offer the trade, where he immediately displays his choice by going to the bowl. It’s quite convenient, because when he chooses, he no longer bothers me later asking to go out again and he’ll inform me when he’s done with the outside.
He took a while to learn this second & more complex exchange. Early on I had to pick him up & put him on the cat-flap so he would then have to decide and start to associate the trade/outcome. But, having succeeded with brushing/clipping, I was curious if I could teach him to trade more usefully, and so I persevered and he gradually got the idea.↩︎
This phenomenon apparently can cause some odd market dynamics:
↩︎But sometimes the Amazon app, acting as a Geiger counter of consumer demand, will light up on something strange, and it’s time to chase a product. [Freelance product buyer] Anderson recently hit half a dozen Walmarts buying Game of Thrones Oreos. Baron discovered the Oreos, too: “We had to hustle really hard, just driving from city to city, filling up the vehicle with every one of these Oreos we could get.”…Discontinued nail polish, Pop-Tarts, hair curling products: Anderson has chased them all when the scanner has shown them fetching multiples of their normal price. He once hunted a particular brand of discontinued dental floss across the Big Lots of America, buying six-packs for $1.26$0.992019 cents and selling them on Amazon for over $127.58$1002019 apiece.
He has no idea why someone would pay so much for such things, but the scanner tells him people do. His best guesses are melancholy ones. Discontinued cat food is a big seller, which he didn’t understand until his mom’s cat grew old and senile and refused to eat any of the new flavors. He once saw a post from a parent whose son was autistic and drank from the same plastic cup every day for 20 years. The cup eventually disintegrated, and he didn’t want to drink from any other vessel. “I’ve always wondered if it’s something like that”, Anderson says.
While plausible & matching my experience & many other anecdotes, Bradshaw provides no primary reference for the existence of this specialized food-phobia learning mechanism, and tracing citations only turned up an echo chamber of secondary/tertiary references. So this claim seems to just be conventional wisdom and not based on any specific experiment/research. I think Bradshaw may be just referring to “conditioned taste aversion” (shown by experiments like Mugford 1977, which Bradford has referenced), without necessarily claiming there is some special extra-strong cat version.↩︎
If you’re wondering about the exact citation for this famous and oft-misquoted Twain quote and you diligently checked Following the Equator and noted that it actually ascribes the chapter epigraphs (of which the cat/stove quote is one) to a Puddn’head Wilson’s New Calendar, fear not—Puddn’head Wilson was just a pseudonym for Mark Twain for publishing a few popular collections of folksy almanac-style wisdom, and this ‘new calendar’ was apparently only in Following the Equator.↩︎
I noticed it seemed to take him a long time to realize I controlled the laser pointer’s dots, and I’m not sure how much he grasps that the laser pointer causes the dot across the room.↩︎
Why do cats do that? Many cat attacks are clearly provoked, and when we read about a Siegfried & Roy-style incident, we can assume there was a reason related to the performance. But there are nevertheless many cases of petting a cat which appears perfectly happy, where the beloved mother-human has done nothing wrong—yet the cat suddenly “turns” and bites your hand/arm/leg (often executing the attack program with all 4 legs or going into the evisceration-kicking mode), going far beyond any normal “play aggression” or “warning nip”, and sometimes resulting in serious injuries.
Why? The usual explanation for the switcheroo of “unsignaled bites” is that they are “overstimulated” and have “too much energy”, which is not really an explanation so much as a label to explain it away, and doesn’t explain much—why, for example, will stray cats who you’ve stroked once “turn”? Or your cat turn without being touched immediately before? Or even touched at all? Or, why is overstimulation expressed as biting & pouncing rather than running away? (I’m reminded of “sugar rushes” as an all-purpose ‘explanation’ for child misbehavior.)
My best guess, based on my own cats, the cat toy/play literature, my previous speculation about knocking-things-over, and watching a bunch of videos on the topic, is that the real explanation is more along the lines of:
Play is preparation for adulthood; in the case of cats, it is almost exclusively about kinds of hunting. Therefore, when the cat can’t control play, it tips over into aggression like biting and scratching. In the cases of apparently spontaneous unsignaled bites, the human has accidentally imitated prey without realizing it, and thus triggered the instinctual hunting sequence. Dr Jekyll turns into Mr Hyde, bent on mayhem & murder.
Highly stimulated and primed for hunting behavior already, the cat cannot easily control or veto this innate reflex—fluttering finger are like small insects, feet under a blanket are like mice hiding in grass, a hand near the belly is like a trapped animal and triggers the grab-and-kick-to-disembowel behavior, while a hand anywhere near the head triggers an anti-bird reflex on whatever is overhead. (Cats are amazing at swatting down or biting things overhead, which would normally be birds.) Prey, of course, are not, and should not be, warned by an attacking cat—the more unexpected the ambush, the better.
Hence, outdoors or feral cats (which are half in hunting mode already) are much more prone to spontaneous biting, but even fully-inside tame cats may attack at full power their beloved owners (instinct is blind). Fixated on the small ‘prey’, they are forced to ignore the rest of the human, even if that human is reacting or hitting them. After the attack sequence ends and they’ve regained control and ‘woken up’ from the blood-trance, they may attempt to apologize by licking or rubbing, knowing that they went far past play-bites—although the damage is done. And since the attack is an instinctive hunting behavior, it cannot be easily trained away or avoided: the best you can do is to try to soak up the prey drive with other kinds of toys, and avoid prey-like movements.
This would be an example of cats’ incomplete domestication—notably, dogs do not spontaneously attack their human families like this (with the exception of the most dangerous breeds bred for fighting, like pit bulls).
Presumably, we would expect petting-induced aggression to correlate with general hunting drive (eg. within lifespan, during the day, across spay/neutering, and by breed).↩︎
I can confirm that while I have seen many cats doing many things outside, whether rolling around or laying down or rubbing their backs on the ground or hiding in tall grass or stalking me, I have yet to see one actually asleep.↩︎
Cat cameras are good for offering perspective on what cats regard as safe & good observation points.
Cats hiding under cars makes much more sense when you watch some footage from a collar-camera, and can see it from the cat-perspective: underneath cars is the perfect place for cats—like tunnels at a playground, they are high enough to crouch to walk through, but too low for adults to easily get at them, while offering shelter from the elements, and a ~360° view with tires useful for hiding behind while observing the outside world.↩︎
Which illustrates the problem. To paraphrase a Wittgenstein anecdote (Anscombe):
Wittgenstein: “But what would it have looked like if it had looked as if cats were unhappy with water bowls near their food or water being added to their wet foods?”
Me: [sad puppy dog eyes while whimpering at him]
Wittgenstein: “Exactly!”
(How would it look if cats missed us when we were gone…?)↩︎
This is also why people are attracted to the ‘noble savage’ lifestyles of Scottish Borderers, Caucasus raiders, horticulturalists, hunter-gatherers, drug dealers or gangsters etc.—whatever the human ‘environment of evolutionary adaptedness’ we may be ‘designed for’, they are closer to it than working in an office job in a city, which is far more powerful & effective but also more difficult & ridiculous.
![Meme by 'Welcome To My Meme Page': mock-serious scientific parody of cats. 'Cats: A Scientific Inventory. By Cornelius Bustard et al, _Nature_, 2001. [_F. Catus_ illustration with cutaway exposing wretched brain size.] The House Cat is a tragic figure. It has a little head with a little brain inside it that is very easy to confuse. Seemingly, it believes anything one tells it. <span class=separator-inline>•</span> We are not writing this to insult Cat owners. Some of them are capable of concealing their desperate psychological infirmities around strangers, which is a great merit to them and indicates a triumphant level of self-mastery and consideration that their pets do not possess. <span class=separator-inline>•</span> It is difficult, however, to write accurately about Cats without sounding like one is generalizing or insulting the Cat itself. While we would never say that, having seen one cat, a man has seen them all, we can confidently assert that if one has seen *three slightly different Cats*, he has. This is not an attack; it's just how it is, and we must make peace with that. <span class=separator-inline>•</span> Because of these limitations, Cats are ubiquitously amusing to us. The Cat is at all times engaged in a struggle between its own primitive desire to maintain its own dignity, and its own foolish behavior, through which it constantly demeans itself before us. We relate to this, for it is how we appear before the eyes of God. [Crudely-edited _Garfield_ cartoon. Panel 1: Jon: 'Did you know that the Ottoman Empire yet reigns?' Panel 2: Garfield continues to lay there. Panel 3: 'If he says it, the it must be so.'] Popular cartoon satirizing the gullibility of _F. catus_—the man states an obvious falsehood to the soft-minded _F. catus_, who promptly accepts it without question. “Cats: A Scientific Inventory”](/doc/cat/psychology/2020-11-13-welcometomymemepage-catsascientificinventory.jpg)
The dignity of cats is intrinsic to their humor & appeal; one of the cat folkore motifs I enjoy is “The King of the Cats”—for it brings out that every cat believes itself to secretly be a king in waiting, unbeknownst to its human servants.↩︎
Being a solitary predator which must prey on many small animals poses a learning problem: how to avoid starvation but also hunting bad things? The kitten plasticity & mothers bringing live prey home appears to be the answer: the mother brings safe food home, and the kitten learns to eat anything it sees being eaten, acquiring its mother’s repertoire. Then limited adult plasticity enables learning the occasional novel association, which can then be passed on to offspring as ‘cultural evolution’.
A striking example of how much cat predation behavior is learned comes from Kuo 1930/Kuo 1938, who raised kittens under a variety of vegetarian/meat diets, rodent-killing-exposure environments, and co-rearing with rats to see what conditions led to rodent-killing. Kuo found that lack of seeing rodent-killing meant many cats would not kill rodents; rodent-killers only killed the kinds they saw their mother kill; and cats reared with rodents in the same cage would not kill adult rodents (although they would kill & eat baby ones that didn’t look like adults)—unless they saw another cat do so & then they would try (but if they failed because it fought back, they would not try again).↩︎
Dogs, incidentally, don’t seem to realize that they are dogs.↩︎
He also declared me dead to him after I brought my new cat home, despite our previously excellent relationship.
Over 10 years later, he was still carrying his grudge and refusing to let me pet him, even crouching all the way down to the floor to avoid my touch. However, within hours of my cat dying & him investigating my now-empty apartment, he had forgiven me and become enthusiastic about me scratching him again!
How could he know so fast? Was he expecting the death? Or did he smell the body I had brought home from the vet to cremate, and somehow understood? (I don’t think it could be the presence or absence of foreign-cat smell on me, because no matter how I washed or what trip I returned from, he shunned me, even from a distance before he could have smelled me; and he sometimes acted friendly until he saw me more clearly and recognized me.)↩︎
Bradshaw’s list: 8 of 24 in captured South African wildcats genetics; 10 of 12 with suspiciously domestic behavior in zoos; 5 of 7 in Mongolia; & a third of French wildcats.↩︎
We can also consider behavior, like hunting. While they hunt frequently, cats are still easily satiated, and after playing with excess prey, will go take a nap or something; people like to laugh at videos of cats being attacked by mice, or anecdotes of cats brought in to hunt rats who then sensibly decide to go find other prey, but this is adaptive behavior. It is particularly striking to contrast cat’s natural behavior to that of dog breeds bred for ‘ratting’ (or rat-baiting), like terriers: fearless of losing an eye and insatiable, terriers will kill, and kill, and keep killing, with records of up to 300 rats an hour. Such an exaggeration of natural behavior could only be sustained in an artificial human bubble.↩︎
See previously Jones & Hart 2019 on emotion readability & adoptability.↩︎
This appears to be further unpublished research, as Bradshaw gives no footnote or reference to it, and Google Scholar turns up nothing which looks relevant.↩︎
Dawson et al 2019a note that current practices are potentially dangerous on the genetic level: commercial & hobbyist dog breeders tend to select dogs for future breeding when quite young (when behavioral measures are even more unstable & unreliable than usual, see also dog behavioral heritabilities) and neuter the rest, while many of the rest of dogs are bred by amateurs in the general population who select even more haphazardly. Even on an environmental level, puppies (like kittens) are heavily influenced by their rearing environment and need the proper stimuli to develop their genetic potentials (as demonstrated by various behavioral genetics research, particularly Scott & Fuller 1965), which may not be adequately provided by either commercial or hobbyist breeders as compared to being reared in ordinary households similar to the ones they are destined to live in as pets.↩︎
Estimates of the American cat population range widely from 60 million to >100 million; cats live ~15 years; hence, to maintain the population, the annual birth rate must be 4–6.6m cats; to merely be the majority, breeders would need to produce several million cats per year, every year, without fail. For comparison, the Cat Fanciers’ Association’s (2018?) history page says it has registered “over 2 million pedigreed cats”… total, since 1906120ya.
To offset strong selection pressures where extremely unfriendly cats are siring up to half of the population, they need to either be considerably in the majority, or practicing stringent counter-selection solely on those traits (neither of which seems true). And then you have all the other cat populations globally: even if American cats are selected on because American cat owners are all buying from fancy expensive cat breeders, what about the rest of the world?↩︎
If this seems improbable, think about the greatly intensified medical care and the increasing willingness of people to pay luxury-prices for pets. My aunt once mentioned that the drugs for her little dog, who despite coming from a breeder had always been messed up with a number of problems, cost $1k—per month; I was flabbergasted that even if she could easily afford it, she would.↩︎
For example, I notice in one of the few large datasets of cat survivals by breeds, a Swedish pet life insurance database for presumably mostly pedigree cats, Ragdolls/Persians/Siamese appear to have the highest mortality rates: “Mortality of Life-Insured Swedish Cats during 1999–7200620ya: Age, Breed, Sex, and Diagnosis”, Egenvall et al 200917ya. Did their selective breeding from a handful of individuals come at a steep genetic cost for overall health?
On the other hand, the authors note that it’s hard to be sure what the numbers mean—the Maine Coons/Norwegian Forest Cats in their dataset live longer but then often die from falls/accidents, consistent with being more likely to be outdoors cats, and as already noted, Ragdolls/Ragamuffins aren’t supposed to be allowed outside (and Persians/Siamese presumably are much more likely to be kept indoors as well), so perhaps the real meaning is that living indoors is bad for cats (due to overfeeding/lack of exercise)?↩︎
Although cats of more leonine proportions might act even more aggressively than they do now—how much of the modal cat reaction of ‘running away’ is simply because they realize how much smaller they are? They’re still highly territorial…↩︎