Cats are (almost) liquid!—Cats selectively rely on body size awareness when negotiating short openings
Is companion animal loss cat-astrophic? Responses of domestic cats to the loss of another companion animal
Generation of Olfactory Compounds in Cat Food Attractants: Chicken Liver-Derived Protein Hydrolysates and Their Contribution to Enhancing Palatability
Too much too soon? Risk factors for fear behavior in foster kittens prior to adoption
Cat owners’ anthropomorphic perceptions of feline emotions and interpretation of photographs
Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis: Supplement
Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis
Feline faces: Unraveling the social function of domestic cat facial signals
Multimodal Communication in the Human-Cat Relationship: A Pilot Study
The Bluestocking, vol 267: fascinated by the smell & taste of earwax
Discrimination of cat-directed speech from human-directed speech in a population of indoor companion cats (Felis catus)
Cats learn the names of their friend cats in their daily lives
Assessing cats' (Felis catus) sensitivity to human pointing gestures
Introduction of adult cats to indirect calorimetry respiration chambers causes increased energy expenditure and respiratory quotient that decrease following acclimation
A domestic cat (Felis silvestris catus) model of triarchic psychopathy factors: Development and initial validation of the CAT-Tri+ questionnaire
Stress-Related Behaviors in Companion Dogs Exposed to Common Household Noises, and Owners’ Interpretations of Their Dogs’ Behaviors
Socio-spatial cognition in cats: Mentally mapping owner’s location from voice
Domestic cats (Felis catus) prefer freely available food over food that requires effort
If I fits I sits: A citizen science investigation into illusory contour susceptibility in domestic cats (Felis silvestris catus)
My cat Chester’s dynamical systems analysyyyyy7777777777777777y7is of the laser pointer and the red dot on the wall: correlation, causation, or SARS-Cov-2 hallucination?
The Mechanics of Social Interactions Between Cats and Their Owners
The Family Dog Is in Sync With Your Kids: Dogs orient and move in synchrony with family members, which may have implications for the emotional development of people and pets
Provision of High Meat Content Food and Object Play Reduce Predation of Wild Animals by Domestic Cats
Cats (Felis catus) Show No Avoidance of People Who Behave Negatively to Their Owner
Family Member, Best Friend, Child or ‘Just’ a Pet, Owners’ Relationship Perceptions and Consequences for Their Cats
Exploratory study of cat adoption in families of children with autism: Impact on children’s social skills and anxiety
Toxoplasmosis: Recent Advances in Understanding the Link Between Infection and Host Behavior
The role of cat eye narrowing movements in cat-human communication
Did we find a copycat? ‘Do as I Do’ in a domestic cat (Felis catus)
The daytime feeding frequency affects appetite-regulating hormones, amino acids, physical activity, and respiratory quotient, but not energy expenditure, in adult cats fed regimens for 21 days
Not the Cat's Meow? The Impact of Posing with Cats on Female Perceptions of Male Dateability
Effectiveness of the Felixer grooming trap for the control of feral cats: a field trial in arid South Australia
The Relationship Between Neuroticism Facets, Conscientiousness, and Human Attachment to Pet Cats
The small home ranges and large local ecological impacts of pet cats
Cats, Once YouTube Stars, Are Now an ‘Emerging Audience’: They’re addicted to channels like Little Kitty & Family, Handsome Nature, and Videos for Your Cat—provided their owners switch on the iPad first
Facial expressions of pain in cats: the development and validation of a Feline Grimace Scale
The Scavenging Patterns of Feral Cats on Human Remains in an Outdoor Setting
Humans can identify cats’ affective states from subtle facial expressions
Motion Illusions as Environmental Enrichment for Zoo Animals: A Preliminary Investigation on Lions (Panthera leo)
The effect of a hiding box on stress levels and body weight in Dutch shelter cats; a randomized controlled trial
A review of the development and functions of cat play, with future research considerations
Dogs Have Masters, Cats Have Staff: Consumers’ Psychological Ownership and Their Economic Valuation of Pets
Intestinal delta-6-desaturase activity determines host range for Toxoplasma sexual reproduction
Cats Parallel Great Apes and Corvids in Motor Self-Regulation—Not Brain but Material Size Matters
The socio-cognitive relationship between cats and humans—Companion cats (Felis catus) as their owners see them
How mammals stay healthy in nature: the evolution of behaviors to avoid parasites and pathogens
Perception of the Delboeuf illusion by the adult domestic cat (Felis silvestris catus) in comparison with other mammals
Effects of latent Toxoplasmosis on olfactory functions of men and women
Use of incidentally encoded memory from a single experience in cats
Habitat preference for fire scars by feral cats in Cape York Peninsula, Australia
Impact of macronutrient composition and palatability in wet diets on food selection in cats
We went to NASA to float on the world’s flattest floor: In a warehouse in Alabama is what may be the flattest floor in the world—one that can, in a sense, simulate space. BBC Future—and some cats—give it a test drive
The Roles of Pet Dogs and Cats in Human Courtship and Dating
The Relationship Between Coat Color and Aggressive Behaviors in the Domestic Cat
What’s inside your cat’s head? A review of cat (Felis silvestris catus) cognition research past, present and future
Stress in owned cats: behavioral changes & welfare implications
Assessing Food Preferences in Dogs and Cats: A Review of the Current Methods
Feral Cats Are Better Killers in Open Habitats, Revealed by Animal-Borne Video
Executive summary of phase 3 of the Bayer veterinary care usage study
Are cats (Felis catus) from multi-cat households more stressed? Evidence from assessment of fecal glucocorticoid metabolite analysis
Chapter 11: Undesired Behavior in the Domestic Cat (The Behavior of the Domestic Cat, Second Edition)
Chapter 12: Physiological and Pathological Causes of Behavioral Change (The Behavior of the Domestic Cat, Second Edition)
Chapter 3: Mechanisms of Behavior (The Behavior of the Domestic Cat, Second Edition)
Chapter 8: Social Behavior (The Behavior of the Domestic Cat, Second Edition)
Escape Behavior of Birds Provides Evidence of Predation Being Involved in Urbanization
Human Perceptions of Coat Color as an Indicator of Domestic Cat Personality
Executive summary of phase 2 of the Bayer veterinary care usage study
The Search for Stability on Narrow Supports: an Experimental Study in Cats and Dogs
Geometric analysis of macronutrient selection in the adult domestic cat, Felis catus
Breed Differences in Behavioral Response to Challenging Situations in Kittens
Why do dogs and cats eat grass? (A) They are sick and need to vomit. (B) They have a dietary deficiency. (C) Studies point to a third option that may may well be the correct answer to this often-asked client question
The influence of visual stimulation on the behavior of cats housed in a rescue shelter
A Case of Recurrent Feline Idiopathic Cystitis: The Control of Clinical Signs With Behavior Therapy
A Comparative Study of the Use of Visual Communicative Signals in Interactions Between Dogs (Canis familiaris) and Humans and Cats (Felis catus) and Humans
Perceptual and Acoustic Evidence for Species-Level Differences in Meow Vocalizations by Domestic Cats (Felis Catus) and African Wild Cats (Felis Silvestris Lybica)
Influence of familiarity and relatedness on proximity and allogrooming in domestic cats (Felis catus)
Object play in adult domestic cats: the roles of habituation and disinhibition
Evidence suggesting pre-adaptation to domestication throughout the small Felidae
Responses of pet cats to being held by an unfamiliar person, from weaning to three years of age
Self-induced Increase of Gut Motility and the Control of Parasitic Infections in Wild Chimpanzees
Long-term follow up of the effect of a pheromone therapy on feline spraying behavior
Chapter 5: The Signaling Repertoire of the Domestic Cat and Its Undomesticated Relatives (The Domestic Cat: The Biology of Its Behavior)
Chapter 7: Density, Spatial Organisation and Reproductive Tactics in the Domestic Cat and Other Felids (The Domestic Cat: The Biology of Its Behavior)
Chapter 10: The Human-Cat Relationship (The Domestic Cat: The Biology of Its Behavior)
Affiliative behavior of related and unrelated pairs of cats in catteries: a preliminary report
The Function of Allogrooming in Domestic Cats (Felis Silvestris Catus); a Study in a Group of Cats Living in Confinement
Visual and tactile communication in the Domestic cat (Felis silvestris catus) and undomesticated small felids
Perceptual Cues That Permit Categorical Differentiation of Animal Species by Infants
Leaf-Swallowing by Chimpanzees: A Behavioral Adaptation for the Control of Strongyle Nematode Infections
Factors Influencing the Reactions of Cats to Humans and Novel Objects
A Game of Cat and House: Spatial Patterns and Behavior of 14 Domestic Cats (Felis Catus) in the Home
Development of Exclusivity in Perceptually Based Categories of Young Infants
Urinary Monitoring of Adrenal Responses to Psychological Stressors in Domestic and Nondomestic Felids
Effects of Early Rearing Experience on Subsequent Adult Sexual Behavior Using Domestic Cats (Felis Catus) As a Model for Exotic Small Felids
The effects of litter-size variation on the development of play behavior in the domestic cat: litters of one and two
Size-Dependent Predation on Rats (Rattus Norvegicus) by House Cats (Felis Catus) in an Urban Setting
The effects of social isolation on the behavior of juvenile domestic cats
Chemocommunication among Domestic Cats, Mediated by the Olfactory and Vomeronasal Senses: I. Chemocommunication
Studies on the Basic Factors in Animal Fighting: VII. Inter-Species Coexistence in Mammals
Furiosa’s Cat Feeder: The Trick Is to Be Smarter Than the Animal With a Brain the Size of a Walnut
The Charles Mingus CAT-Alog for Toilet Training Your Cat [1954]
I Can’t Give My Cat the Perfect Life. ‘TV for Cats’ Gives Her a Taste.
Researchers Put Little Hats on Cats to Measure Their Brainwaves
Non-Invasive Electroencephalography in Awake Cats: Feasibility and Application to Sensory Processing in Chronic Pain
Morbid Attraction to Leopard Urine in Toxoplasma-Infected Chimpanzees
Japanese Researcher Publishes Study on Quality of Sleep When Pet Cats Choose Location of Slumber
In Search of the Heart of the Online Cat-Industrial Complex
2024-pongracz-figure2-schematicofdifferentsizedcatopenings.jpg
2023-11-16-gwern-dalle3-comic-cat-problemofinductiontestingknockingobjectsover.jpg
2023-11-04-gwern-midjourneyv5-cat-linocutofblackcatshapedlikequestionmark-cropped-thumbnail.jpg
2023-11-04-gwern-midjourneyv5-cat-linocutofblackcatshapedlikequestionmark.jpg
2023-11-04-jacobjanerka-cattryingtohideinapatchofgrassinthemiddleofamownlawn.jpg
2023-11-03-gwern-midjourneyv5-anxiousblackcatatwindowsill-cropped-thumbnail.jpg
2023-11-03-gwern-midjourneyv5-anxiousblackcatatwindowsill.jpg
2022-06-03-gwern-meme-claspedarms-aristotlecatsharedfearofvaccuumshorrorvacui.jpg
2021-04-17-henry-doesyourcatsbuttholereallytouchallthesurfacesinyourhome.html
2020-11-13-welcometomymemepage-catsascientificinventory.jpg
2019-vanderleij-figure1-sheltercatstressscoresovertimesplitbetweencatsgivencatboxesandcontrolcats.jpg
2019-vanderleij-figure2-weightlossinsheltercatsgivencatboxvscontrolcats.png
1971-bartoshuk-figure2-catpreferenceforsugarwaterwhentasteunmaskedbytablesalt.png
http://cdn2.discoverwildlife.com/british-wildlife/cats-and-wildlife-hunter-suburbia
https://aeon.co/essays/why-keeping-a-pet-is-fundamentally-unethical
https://lareviewofbooks.org/article/the-pets-war-on-hilda-keans-the-great-cat-and-dog-massacre/
https://onlinelibrary.wiley.com/doi/full/10.1002/ece3.11524
https://www.cell.com/trends/ecology-evolution/fulltext/S0169-5347(20)30010-0
https://www.frontiersin.org/articles/10.3389/fevo.2018.00146/full
https://www.frontiersin.org/journals/veterinary-science/articles/10.3389/fvets.2024.1403068/full
https://www.reddit.com/r/MachineLearning/comments/jthxui/p_chasing_intruding_cats_from_your_home_with/
https://www.smithsonianmag.com/smart-news/cats-make-nearly-300-different-facial-expressions-180983185/
https://www.tiktok.com/@pageandwhisker/video/7099952695003467014
https://www.vox.com/future-perfect/2023/4/11/23673393/pets-dogs-cats-animal-welfare-boredom
Cats are (almost) liquid!—Cats selectively rely on body size awareness when negotiating short openings
https%253A%252F%252Fwww.cell.com%252Fiscience%252Ffulltext%252FS2589-0042%252824%252902024-8.html
Is companion animal loss cat-astrophic? Responses of domestic cats to the loss of another companion animal
Generation of Olfactory Compounds in Cat Food Attractants: Chicken Liver-Derived Protein Hydrolysates and Their Contribution to Enhancing Palatability
Too much too soon? Risk factors for fear behavior in foster kittens prior to adoption
Cat owners’ anthropomorphic perceptions of feline emotions and interpretation of photographs
https%253A%252F%252Fwww.sciencedirect.com%252Fscience%252Farticle%252Fpii%252FS0168159123003222.html
Cat Ownership and Schizophrenia-Related Disorders and Psychotic-Like Experiences: A Systematic Review and Meta-Analysis
Feline faces: Unraveling the social function of domestic cat facial signals
Discrimination of cat-directed speech from human-directed speech in a population of indoor companion cats (Felis catus)
%252Fdoc%252Fcat%252Fpsychology%252F2022-demouzon.pdf.html
Cats learn the names of their friend cats in their daily lives
https%253A%252F%252Fwww.nature.com%252Farticles%252Fs41598-022-10261-5.html
If I fits I sits: A citizen science investigation into illusory contour susceptibility in domestic cats (Felis silvestris catus)
Cats (Felis catus) Show No Avoidance of People Who Behave Negatively to Their Owner
%252Fdoc%252Fcat%252Fpsychology%252F2021-chijiiwa.pdf.html
The role of cat eye narrowing movements in cat-human communication
https%253A%252F%252Fwww.nature.com%252Farticles%252Fs41598-020-73426-0.html
Not the Cat's Meow? The Impact of Posing with Cats on Female Perceptions of Male Dateability
https%253A%252F%252Fwww.mdpi.com%252F2076-2615%252F10%252F6%252F1007.html
The Relationship Between Neuroticism Facets, Conscientiousness, and Human Attachment to Pet Cats
%252Fdoc%252Fpsychology%252Fpersonality%252F2020-reevy-2.pdf.html
Cats, Once YouTube Stars, Are Now an ‘Emerging Audience’: They’re addicted to channels like Little Kitty & Family, Handsome Nature, and Videos for Your Cat—provided their owners switch on the iPad first
https%253A%252F%252Fwww.wired.com%252Fstory%252Fcats-watch-youtube%252F.html
The socio-cognitive relationship between cats and humans—Companion cats (Felis catus) as their owners see them
%252Fdoc%252Fcat%252Fpsychology%252F2018-pongracz.pdf.html
The Roles of Pet Dogs and Cats in Human Courtship and Dating
Human Perceptions of Coat Color as an Indicator of Domestic Cat Personality
A Comparative Study of the Use of Visual Communicative Signals in Interactions Between Dogs (Canis familiaris) and Humans and Cats (Felis catus) and Humans
Responses of pet cats to being held by an unfamiliar person, from weaning to three years of age
A Game of Cat and House: Spatial Patterns and Behavior of 14 Domestic Cats (Felis Catus) in the Home
%252Fdoc%252Fcat%252Fpsychology%252F1996-bernstein.pdf.html
%252Fdoc%252Fcat%252Fpsychology%252F1969-leyhausen.pdf.html
Wikipedia Bibliography:
